BLASTX nr result
ID: Chrysanthemum22_contig00005508
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00005508 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH91008.1| Protein of unknown function DUF3527 [Cynara cardu... 69 7e-11 >gb|KVH91008.1| Protein of unknown function DUF3527 [Cynara cardunculus var. scolymus] Length = 619 Score = 68.9 bits (167), Expect = 7e-11 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 8/73 (10%) Frame = +2 Query: 215 ISETMDNAIVHANIIGYKND-----PNKDSESPEEDCVSEILAKH---GDVSPSSIKRLQ 370 +S+ MDNAIVHA I+GY N PNKD ES +EDC+SEI+ + GDV PSS+K Sbjct: 1 MSDKMDNAIVHAKIVGYNNGSPLQAPNKDFESSKEDCLSEIMPREVNPGDVLPSSLK--- 57 Query: 371 RLQISDYCAQNHF 409 +LQISD+ Q F Sbjct: 58 KLQISDFSTQKLF 70