BLASTX nr result
ID: Chrysanthemum22_contig00005425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00005425 (1436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023743508.1| E3 ubiquitin-protein ligase SIS3-like [Lactu... 92 1e-16 ref|XP_021984040.1| E3 ubiquitin-protein ligase SIS3-like [Helia... 91 2e-16 ref|XP_022015669.1| E3 ubiquitin-protein ligase SIS3 isoform X2 ... 90 4e-16 ref|XP_023752351.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 7e-16 ref|XP_022015668.1| E3 ubiquitin-protein ligase SIS3 isoform X1 ... 90 8e-16 gb|KZV34735.1| hypothetical protein F511_00637 [Dorcoceras hygro... 88 8e-16 ref|XP_023531325.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 9e-16 ref|XP_023007717.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 9e-16 ref|XP_022933582.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 9e-16 ref|XP_023516683.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 9e-16 ref|XP_022988386.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 9e-16 gb|KRH63517.1| hypothetical protein GLYMA_04G1821002, partial [G... 85 1e-15 ref|XP_006345049.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 ... 89 1e-15 ref|XP_011657565.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 ... 89 1e-15 ref|XP_022135065.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 1e-15 ref|XP_023752350.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 1e-15 gb|AQK91776.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] 85 1e-15 ref|XP_022135064.1| E3 ubiquitin-protein ligase SIS3-like isofor... 89 2e-15 ref|XP_008453098.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-... 89 2e-15 ref|XP_004138113.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 ... 89 2e-15 >ref|XP_023743508.1| E3 ubiquitin-protein ligase SIS3-like [Lactuca sativa] gb|PLY66385.1| hypothetical protein LSAT_4X75421 [Lactuca sativa] Length = 364 Score = 92.4 bits (228), Expect = 1e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAVFAIP 139 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCRSSVFPNLDL+A+ IP Sbjct: 248 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLNALPTIP 293 >ref|XP_021984040.1| E3 ubiquitin-protein ligase SIS3-like [Helianthus annuus] gb|OTG16520.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 360 Score = 91.3 bits (225), Expect = 2e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAVFAIP 139 +VRGLPCA+NFHVGCIDEWL+LNVKCPRCRSSVFP+LDLSA+ IP Sbjct: 248 EVRGLPCAHNFHVGCIDEWLKLNVKCPRCRSSVFPDLDLSALSTIP 293 >ref|XP_022015669.1| E3 ubiquitin-protein ligase SIS3 isoform X2 [Helianthus annuus] Length = 305 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAVFAIP 139 +VRGLPCA+NFHV CIDEWLRLNVKCPRCR SVFPNLDLSA+ IP Sbjct: 190 EVRGLPCAHNFHVACIDEWLRLNVKCPRCRCSVFPNLDLSALQTIP 235 >ref|XP_023752351.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Lactuca sativa] Length = 301 Score = 89.0 bits (219), Expect = 7e-16 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAVFAIP 139 +VRGLPCA+NFHV CIDEWLRLNVKCPRCR SVFPNLDL+A+ IP Sbjct: 191 EVRGLPCAHNFHVACIDEWLRLNVKCPRCRCSVFPNLDLTALSTIP 236 >ref|XP_022015668.1| E3 ubiquitin-protein ligase SIS3 isoform X1 [Helianthus annuus] gb|OTF92019.1| putative SUGAR-INSENSITIVE 3 [Helianthus annuus] Length = 362 Score = 89.7 bits (221), Expect = 8e-16 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAVFAIP 139 +VRGLPCA+NFHV CIDEWLRLNVKCPRCR SVFPNLDLSA+ IP Sbjct: 247 EVRGLPCAHNFHVACIDEWLRLNVKCPRCRCSVFPNLDLSALQTIP 292 >gb|KZV34735.1| hypothetical protein F511_00637 [Dorcoceras hygrometricum] Length = 256 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAVFAI 136 +VRGLPCA+NFHV CIDEWLRLNVKCPRCR SVFPNLDLSA+ +I Sbjct: 127 EVRGLPCAHNFHVECIDEWLRLNVKCPRCRCSVFPNLDLSAISSI 171 >ref|XP_023531325.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 322 Score = 89.0 bits (219), Expect = 9e-16 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 192 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 233 >ref|XP_023007717.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Cucurbita maxima] Length = 322 Score = 89.0 bits (219), Expect = 9e-16 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 192 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 233 >ref|XP_022933582.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Cucurbita moschata] Length = 322 Score = 89.0 bits (219), Expect = 9e-16 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 192 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 233 >ref|XP_023516683.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 323 Score = 89.0 bits (219), Expect = 9e-16 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 190 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 231 >ref|XP_022988386.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Cucurbita maxima] Length = 323 Score = 89.0 bits (219), Expect = 9e-16 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 190 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 231 >gb|KRH63517.1| hypothetical protein GLYMA_04G1821002, partial [Glycine max] Length = 170 Score = 85.1 bits (209), Expect = 1e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 QVRGLPCA+NFHV CIDEWLRLNV CPRCR SVFPNLDLSA+ Sbjct: 38 QVRGLPCAHNFHVECIDEWLRLNVNCPRCRCSVFPNLDLSAL 79 >ref|XP_006345049.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 [Solanum tuberosum] Length = 377 Score = 89.4 bits (220), Expect = 1e-15 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAVFAIP 139 +VRGLPCA+NFHV CIDEWLRLNVKCPRCR SVFPNLDLSA+ IP Sbjct: 247 EVRGLPCAHNFHVACIDEWLRLNVKCPRCRCSVFPNLDLSALSNIP 292 >ref|XP_011657565.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 isoform X2 [Cucumis sativus] Length = 355 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 225 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 266 >ref|XP_022135065.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Momordica charantia] Length = 356 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 230 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 271 >ref|XP_023752350.1| E3 ubiquitin-protein ligase SIS3-like isoform X1 [Lactuca sativa] gb|PLY94134.1| hypothetical protein LSAT_5X17200 [Lactuca sativa] Length = 358 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAVFAIP 139 +VRGLPCA+NFHV CIDEWLRLNVKCPRCR SVFPNLDL+A+ IP Sbjct: 248 EVRGLPCAHNFHVACIDEWLRLNVKCPRCRCSVFPNLDLTALSTIP 293 >gb|AQK91776.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] Length = 167 Score = 84.7 bits (208), Expect = 1e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHV CID+WLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 72 EVRGLPCAHNFHVECIDQWLRLNVKCPRCRCSVFPNLDLSAL 113 >ref|XP_022135064.1| E3 ubiquitin-protein ligase SIS3-like isoform X1 [Momordica charantia] Length = 373 Score = 89.0 bits (219), Expect = 2e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 247 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 288 >ref|XP_008453098.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like [Cucumis melo] Length = 377 Score = 89.0 bits (219), Expect = 2e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 247 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 288 >ref|XP_004138113.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 isoform X1 [Cucumis sativus] gb|KGN63587.1| hypothetical protein Csa_1G004990 [Cucumis sativus] Length = 377 Score = 89.0 bits (219), Expect = 2e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 QVRGLPCANNFHVGCIDEWLRLNVKCPRCRSSVFPNLDLSAV 127 +VRGLPCA+NFHVGCIDEWLRLNVKCPRCR SVFPNLDLSA+ Sbjct: 247 EVRGLPCAHNFHVGCIDEWLRLNVKCPRCRCSVFPNLDLSAL 288