BLASTX nr result
ID: Chrysanthemum22_contig00005261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00005261 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022033722.1| late embryogenesis abundant protein Dc3-like... 56 6e-07 >ref|XP_022033722.1| late embryogenesis abundant protein Dc3-like [Helianthus annuus] gb|OTG27147.1| putative late embryogenesis abundant protein Dc3 [Helianthus annuus] Length = 159 Score = 55.8 bits (133), Expect = 6e-07 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +1 Query: 265 KMLGNIKDKALEAQKMTTDAAGSAWEKTVESKDQAGTKVSETSTVVVDK 411 +M+GN+KDKA + + T+ AAGSAW+KT ES DQ G+ VSE + DK Sbjct: 23 QMMGNVKDKAQQGKDKTSGAAGSAWDKTKESADQTGSYVSEKTGAARDK 71