BLASTX nr result
ID: Chrysanthemum22_contig00005122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00005122 (902 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ATG83018.1| photosystem II protein M (chloroplast) [Phoenix d... 97 5e-22 dbj|GAY33504.1| hypothetical protein CUMW_286780 [Citrus unshiu] 84 2e-17 ref|YP_009409886.1| photosystem II protein M (chloroplast) [Cres... 73 5e-17 ref|WP_078101538.1| photosystem II reaction center protein PsbM ... 82 1e-16 gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium r... 80 7e-16 gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophi... 72 9e-13 gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sat... 72 2e-12 gb|ANF05123.1| photosystem II protein M (chloroplast) [Cynanchum... 71 2e-12 gb|EFH64612.1| hypothetical protein ARALYDRAFT_893970 [Arabidops... 71 9e-12 ref|WP_082924831.1| photosystem II reaction center protein PsbM,... 69 1e-11 gb|AKF01761.1| photosystem II protein M (chloroplast) [Iriartea ... 67 4e-11 ref|YP_398315.1| photosystem II reaction center M protein [Lactu... 67 5e-11 ref|YP_009373817.1| PsbM (chloroplast) [Soliva sessilis] >gi|117... 67 5e-11 ref|YP_009404150.1| photosystem II protein M (plastid) [Lobelia ... 67 6e-11 ref|YP_009403880.1| photosystem II protein M (plastid) [Lobelia ... 67 6e-11 ref|YP_009145255.1| photosystem II protein M (plastid) [Trillium... 67 6e-11 gb|ATL76538.1| photosystem II protein M (plastid) [Chenopodium a... 67 6e-11 ref|YP_009262745.1| photosystem II protein M (chloroplast) [Ludi... 66 7e-11 ref|YP_009154945.1| photosystem II M protein (chloroplast) [Gent... 66 7e-11 ref|YP_009108837.1| photosystem II protein M [Pentalinon luteum]... 66 7e-11 >gb|ATG83018.1| photosystem II protein M (chloroplast) [Phoenix dactylifera] Length = 70 Score = 97.1 bits (240), Expect = 5e-22 Identities = 52/63 (82%), Positives = 57/63 (90%) Frame = -1 Query: 416 IELTGERFIISMGLNPELLYCEIKKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTV 237 +ELTG +F+ISMGL+PELL KKN+EIMEVNILAFIATALFILVPTAFLLIIYVKTV Sbjct: 11 VELTGVKFLISMGLDPELLR---SKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTV 67 Query: 236 SQN 228 SQN Sbjct: 68 SQN 70 >dbj|GAY33504.1| hypothetical protein CUMW_286780 [Citrus unshiu] Length = 53 Score = 84.3 bits (207), Expect = 2e-17 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -1 Query: 383 MGLNPELLYCEIKKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MGLNPELL + KK NDE MEVNILAFIAT LF+LVPTAFLLIIYVKTVSQ++ Sbjct: 1 MGLNPELLRSKKKKPNDETMEVNILAFIATTLFVLVPTAFLLIIYVKTVSQSD 53 >ref|YP_009409886.1| photosystem II protein M (chloroplast) [Cressa cretica] gb|ASJ65073.1| photosystem II protein M (chloroplast) [Cressa cretica] Length = 79 Score = 72.8 bits (177), Expect(3) = 5e-17 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 353 EIKKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 ++KK+ DEIMEVNILAFIATALFILVPTAF LIIYVKTVSQ++ Sbjct: 37 KLKKRRDEIMEVNILAFIATALFILVPTAFFLIIYVKTVSQSD 79 Score = 35.4 bits (80), Expect(3) = 5e-17 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 420 IH*IDR*KIYHLYGIKSRVIVL*NKKKKR*D 328 IH I + KIYHLYGIKSRVI K KKR D Sbjct: 16 IHCIFKRKIYHLYGIKSRVIA---KLKKRRD 43 Score = 28.9 bits (63), Expect(3) = 5e-17 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 Query: 469 IVIHDIDPIQYRR*VMHSL 413 + IHDIDPI+Y R V+H + Sbjct: 1 MAIHDIDPIRYHRDVIHCI 19 >ref|WP_078101538.1| photosystem II reaction center protein PsbM [Staphylococcus aureus] gb|KJB13068.1| hypothetical protein B456_002G055100 [Gossypium raimondii] Length = 50 Score = 82.4 bits (202), Expect = 1e-16 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -1 Query: 383 MGLNPELLYCEIKKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MGLNPELL KKN+EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ++ Sbjct: 1 MGLNPELLR---SKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 50 >gb|KJB80637.1| hypothetical protein B456_013G108100 [Gossypium raimondii] Length = 50 Score = 80.1 bits (196), Expect = 7e-16 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -1 Query: 383 MGLNPELLYCEIKKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MGLNPELL KKN+EIMEVNILAFIATALFILVPTAFLLIIYVKT+ Q++ Sbjct: 1 MGLNPELLR---SKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTICQSD 50 >gb|ADD63027.1| photosystem II protein M (chloroplast) [Potamophila parviflora] Length = 69 Score = 72.4 bits (176), Expect = 9e-13 Identities = 43/64 (67%), Positives = 46/64 (71%) Frame = -1 Query: 416 IELTGERFIISMGLNPELLYCEIKKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTV 237 +E TG F P YCE K E+MEVNILAFIATALFILVPTAFLLIIYVKTV Sbjct: 12 LEFTGYPFYSPWDYIPS--YCEKK----EVMEVNILAFIATALFILVPTAFLLIIYVKTV 65 Query: 236 SQNN 225 SQN+ Sbjct: 66 SQND 69 >gb|AAS46110.1| photosystem II M protein (chloroplast) [Oryza sativa Japonica Group] gb|AAS46173.1| photosystem II M protein (chloroplast) [Oryza sativa Japonica Group] gb|ADD62823.1| photosystem II protein M (chloroplast) [Oryza sativa Japonica Group] gb|ADD62891.1| photosystem II protein M (chloroplast) [Oryza meridionalis] gb|ADD62959.1| photosystem II protein M (chloroplast) [Oryza australiensis] gb|AGY48933.1| photosystem II reaction center protein M (chloroplast) [Oryza rufipogon] Length = 69 Score = 71.6 bits (174), Expect = 2e-12 Identities = 43/64 (67%), Positives = 46/64 (71%) Frame = -1 Query: 416 IELTGERFIISMGLNPELLYCEIKKKNDEIMEVNILAFIATALFILVPTAFLLIIYVKTV 237 +E TG F P YCE K E+MEVNILAFIATALFILVPTAFLLIIYVKTV Sbjct: 12 LEFTGYPFPSPWDYIPS--YCEKK----EVMEVNILAFIATALFILVPTAFLLIIYVKTV 65 Query: 236 SQNN 225 SQN+ Sbjct: 66 SQND 69 >gb|ANF05123.1| photosystem II protein M (chloroplast) [Cynanchum auriculatum] Length = 50 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 360 VL*NKKKKR*DYGSKYSCIYCYCTVHFSSYCFSTYNLRKNSKSK 229 +L +KKKKR DYGSKYSCI CYCT+H SSY STY+LRKN++SK Sbjct: 7 LLRSKKKKRLDYGSKYSCICCYCTIHSSSYRLSTYHLRKNNQSK 50 >gb|EFH64612.1| hypothetical protein ARALYDRAFT_893970 [Arabidopsis lyrata subsp. lyrata] Length = 120 Score = 71.2 bits (173), Expect = 9e-12 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 243 FYVNYK*KSSRN*NEQCSSNKCKNIYFHNLIVFFFYF 353 FYVNYK KSSRN NE+C SNKCKNIYFHNLIV+++YF Sbjct: 74 FYVNYKQKSSRNENEECGSNKCKNIYFHNLIVYYYYF 110 >ref|WP_082924831.1| photosystem II reaction center protein PsbM, partial [Paenarthrobacter nicotinovorans] Length = 39 Score = 68.6 bits (166), Expect = 1e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 341 KNDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 K +EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ++ Sbjct: 1 KKNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 39 >gb|AKF01761.1| photosystem II protein M (chloroplast) [Iriartea deltoidea] Length = 35 Score = 67.0 bits (162), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 329 IMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 +MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MMEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 35 >ref|YP_398315.1| photosystem II reaction center M protein [Lactuca sativa] ref|YP_567070.1| photosystem II protein M (chloroplast) [Vitis vinifera] ref|YP_817476.1| photosystem II protein M (chloroplast) [Coffea arabica] ref|YP_001123193.1| PSII low MW protein [Arabis hirsuta] ref|YP_001123544.1| PSII low MW protein [Draba nemorosa] ref|YP_001123719.1| photosystem II protein M [Lobularia maritima] ref|YP_001718682.1| photosystem II protein M [Trachelium caeruleum] ref|YP_002000476.1| photosystem II protein M (chloroplast) [Brachypodium distachyon] ref|YP_004465174.1| photosystem II protein M [Jacobaea vulgaris] ref|YP_005089946.1| psbM gene product (chloroplast) [Brassica napus] ref|YP_007353752.1| photosystem II M protein (chloroplast) [Chrysanthemum x morifolium] ref|YP_007474715.1| PsbM (chloroplast) [Chrysanthemum indicum] ref|YP_007624781.1| photosystem II reaction center M protein (chloroplast) [Artemisia frigida] ref|YP_008963389.1| photosystem II protein M (chloroplast) [Sedum sarmentosum] ref|YP_009000326.1| psbM protein (chloroplast) [Arabis alpina] ref|YP_008999929.1| photosystem II protein M (chloroplast) [Agrostemma githago] ref|YP_009019785.1| photosystem II protein M (chloroplast) [Vitis rotundifolia] ref|YP_009046908.1| photosystem II protein M (chloroplast) [Raphanus sativus] ref|YP_009048569.1| photosystem II protein M [Paris verticillata] ref|YP_009053990.1| photosystem II reaction center M protein (chloroplast) [Hanabusaya asiatica] ref|YP_009111723.1| photosystem II reaction center M protein (chloroplast) [Artemisia montana] ref|YP_009116007.1| photosystem II reaction center M protein (chloroplast) [Campanula takesimana] ref|YP_009130036.1| photosystem II protein M (chloroplast) [Campynema lineare] ref|YP_009129425.1| photosystem II protein M (chloroplast) [Goodyera fumata] ref|YP_009135597.1| photosystem II protein M (plastid) [Zizania aquatica] ref|YP_009136983.1| photosystem II reaction center M protein (chloroplast) [Adenophora remotiflora] ref|YP_009142566.1| photosystem II protein M (plastid) [Trillium cuneatum] ref|YP_009160796.1| photosystem II protein M (chloroplast) [Haloxylon ammodendron] ref|YP_009160881.1| photosystem II protein M (chloroplast) [Haloxylon persicum] ref|YP_009163190.1| photosystem II protein M (plastid) [Trillium maculatum] ref|YP_009163273.1| photosystem II protein M (plastid) [Trillium tschonoskii] ref|YP_009166877.1| photosystem II protein M (chloroplast) [Osyris alba] ref|YP_009177859.1| photosystem II protein M (chloroplast) [Brassica juncea] ref|YP_009179724.1| PSII low MW protein (chloroplast) [Isatis tinctoria] ref|YP_009186603.1| photosystem II protein M (plastid) [Brighamia insignis] ref|YP_009192695.1| photosystem II protein M (chloroplast) [Schrenkiella parvula] ref|YP_009221801.1| photosystem II protein M (chloroplast) [Mesembryanthemum crystallinum] ref|YP_009229675.1| photosystem II protein M (chloroplast) [Cochlearia borzaeana] ref|YP_009229758.1| photosystem II protein M (chloroplast) [Cochlearia islandica] ref|YP_009230565.1| photosystem II protein M (chloroplast) [Cochlearia pyrenaica] ref|YP_009230648.1| photosystem II protein M (chloroplast) [Cochlearia tridactylites] ref|YP_009230731.1| photosystem II protein M (chloroplast) [Ionopsidium acaule] ref|YP_009231241.1| photosystem II protein M (chloroplast) [Tetrastigma hemsleyanum] ref|YP_009231905.1| photosystem II protein M (chloroplast) [Goodyera velutina] ref|YP_009233248.1| photosystem II protein M (chloroplast) [Zizania latifolia] ref|YP_009234976.1| photosystem II protein M (chloroplast) [Papaver somniferum] ref|YP_009235337.1| photosystem II protein M (chloroplast) [Vitis aestivalis] ref|YP_009239193.1| photosystem II protein M (chloroplast) [Pedicularis ishidoyana] ref|YP_009251119.1| photosystem II protein M (chloroplast) [Coffea canephora] ref|YP_009258960.1| photosystem II protein M (chloroplast) [Spathiphyllum kochii] ref|YP_009259573.1| PsbM (chloroplast) [Brassica nigra] ref|YP_009261690.1| photosystem II protein M (chloroplast) [Pugionium dolabratum] ref|YP_009261775.1| photosystem II protein M (chloroplast) [Pugionium cornutum] ref|YP_009271368.1| PsbM (chloroplast) [Taraxacum officinale] ref|YP_009271561.1| photosystem II protein M (chloroplast) [Cakile arabica] ref|YP_009272063.1| PsbM (chloroplast) [Artemisia argyi] ref|YP_009294957.1| photosystem II M protein (chloroplast) [Swertia mussotii] ref|YP_009306932.1| photosystem II protein M (chloroplast) [Vitis amurensis] ref|YP_009307465.1| PsbM (chloroplast) [Taraxacum platycarpum] ref|YP_009307552.1| PsbM (chloroplast) [Taraxacum mongolicum] ref|YP_009307738.1| PsbM (chloroplast) [Artemisia gmelinii] ref|YP_009307826.1| PsbM (chloroplast) [Artemisia capillaris] ref|YP_009316531.1| photosystem II protein M (chloroplast) [Taraxacum obtusifrons] ref|YP_009316616.1| photosystem II protein M (chloroplast) [Taraxacum amplum] ref|YP_009320266.1| photosystem II protein M (chloroplast) [Pericallis hybrida] ref|YP_009326107.1| photosystem II protein M (chloroplast) [Oxyria sinensis] ref|YP_009327472.1| photosystem II protein M (chloroplast) [Taraxacum brevicorniculatum] ref|YP_009327554.1| photosystem II protein M (chloroplast) [Taraxacum kok-saghyz] ref|YP_009338063.1| photosystem II reaction center M protein (plastid) [Campanula punctata] ref|YP_009339339.1| photosystem II protein M (plastid) [Cyanea fissa] ref|YP_009339429.1| photosystem II protein M (plastid) [Delissea rhytidosperma] ref|YP_009339519.1| photosystem II protein M (plastid) [Lithotoma petraea] ref|YP_009339598.1| photosystem II protein M (plastid) [Lobelia anceps] ref|YP_009339695.1| photosystem II protein M (plastid) [Lobelia boninensis] ref|YP_009339785.1| photosystem II protein M (plastid) [Lobelia inflata] ref|YP_009339874.1| photosystem II protein M (plastid) [Lobelia jasionoides] ref|YP_009339964.1| photosystem II protein M (plastid) [Lobelia laxiflora] ref|YP_009340053.1| photosystem II protein M (plastid) [Lobelia longisepala] ref|YP_009340141.1| photosystem II protein M (plastid) [Lobelia morogoroensis] ref|YP_009340230.1| photosystem II protein M (plastid) [Lobelia polyphylla] ref|YP_009340320.1| photosystem II protein M (plastid) [Lobelia stricklandiae] ref|YP_009340410.1| photosystem II protein M (plastid) [Lobelia thuliniana] ref|YP_009340562.1| photosystem II protein M (plastid) [Wimmerella hederacea] ref|YP_009343436.1| photosystem II protein M (chloroplast) [Paris mairei] ref|YP_009342501.1| photosystem II protein M (chloroplast) [Orychophragmus diffusus] ref|YP_009342586.1| photosystem II protein M (chloroplast) [Orychophragmus taibaiensis] ref|YP_009342671.1| photosystem II protein M (chloroplast) [Orychophragmus hupehensis] ref|YP_009343100.1| photosystem II protein M (chloroplast) [Paris cronquistii] ref|YP_009343183.1| photosystem II protein M (chloroplast) [Paris dunniana] ref|YP_009343266.1| photosystem II protein M (chloroplast) [Paris fargesii] ref|YP_009343352.1| photosystem II protein M (chloroplast) [Paris luquanensis] ref|YP_009343520.1| photosystem II protein M (chloroplast) [Paris marmorata] ref|YP_009343688.1| photosystem II protein M (chloroplast) [Paris polyphylla var. yunnanensis] ref|YP_009343772.1| photosystem II protein M (chloroplast) [Paris vietnamensis] ref|YP_009343858.1| photosystem II protein M (chloroplast) [Paris quadrifolia] ref|YP_009347699.1| photosystem II protein M (chloroplast) [Anoectochilus emeiensis] ref|YP_009353300.1| photosystem II protein M (chloroplast) [Sinalliaria limprichtiana var. grandifolia] ref|YP_009353380.1| photosystem II protein M (chloroplast) [Sinalliaria limprichtiana] ref|YP_009353744.1| PsbM (chloroplast) [Alyssum desertorum] ref|YP_009355928.1| PSII low MW protein (chloroplast) [Megadenia pygmaea] ref|YP_009356177.1| PSII low MW protein (chloroplast) [Megacarpaea delavayi] ref|YP_009365227.1| photosystem II reaction center M protein (plastid) [Artemisia annua] ref|YP_009366507.1| photosystem II protein M (plastid) [Mitragyna speciosa] ref|YP_009371281.1| PsbM (chloroplast) [Diplostephium pulchrum] ref|YP_009371366.1| PsbM (chloroplast) [Diplostephium jelskii] ref|YP_009371621.1| PsbM (chloroplast) [Diplostephium juniperinum] ref|YP_009371706.1| PsbM (chloroplast) [Diplostephium oxapampanum] ref|YP_009371451.1| PsbM (chloroplast) [Diplostephium lechleri] ref|YP_009371536.1| PsbM (chloroplast) [Lagenophora cuchumatanica] ref|YP_009372301.1| PsbM (chloroplast) [Diplostephium spinulosum] ref|YP_009372811.1| PsbM (chloroplast) [Diplostephium sagasteguii] ref|YP_009372980.1| PsbM (chloroplast) [Diplostephium oblanceolatum] ref|YP_009373065.1| PsbM (chloroplast) [Diplostephium hippophae] ref|YP_009373150.1| PsbM (chloroplast) [Diplostephium hartwegii] ref|YP_009373732.1| PsbM (chloroplast) [Diplostephium cinerascens] ref|YP_009374071.1| PsbM (chloroplast) [Diplostephium glandulosum] ref|YP_009374241.1| PsbM (chloroplast) [Diplostephium callilepis] ref|YP_009374326.1| PsbM (chloroplast) [Diplostephium floribundum] ref|YP_009374751.1| PsbM (chloroplast) [Diplostephium gynoxyoides] ref|YP_009375601.1| PsbM (chloroplast) [Diplostephium cajamarquillense] ref|YP_009376451.1| PsbM (chloroplast) [Diplostephium azureum] ref|YP_009376536.1| PsbM (chloroplast) [Diplostephium foliosissimum] ref|YP_009376791.1| PsbM (chloroplast) [Diplostephium cayambense] ref|YP_009376961.1| PsbM (chloroplast) [Floscaldasia hypsophila] ref|YP_009379607.1| PsbM (chloroplast) [Hydrangea hydrangeoides] ref|YP_009373986.1| PsbM (chloroplast) [Diplostephium barclayanum] ref|YP_009375176.1| PsbM (chloroplast) [Diplostephium gnidioides] ref|YP_009375431.1| PsbM (chloroplast) [Diplostephium ericoides] ref|YP_009375516.1| PsbM (chloroplast) [Diplostephium haenkei] ref|YP_009376281.1| PsbM (chloroplast) [Diplostephium espinosae] ref|YP_009377216.1| PsbM (chloroplast) [Diplostephium empetrifolium] ref|YP_009378066.1| PsbM (chloroplast) [Diplostephium goodspeedii] ref|YP_009379258.1| photosystem II protein M (plastid) [Champereia manillana] ref|YP_009379433.1| PsbM (chloroplast) [Hydrangea serrata] ref|YP_009379519.1| PsbM (chloroplast) [Hydrangea petiolaris] ref|YP_009403553.1| photosystem II protein M (plastid) [Hippobroma longiflora] ref|YP_009404240.1| photosystem II protein M (plastid) [Lobelia bequaertii] ref|YP_009404777.1| photosystem II protein M (plastid) [Lobelia kauaensis] ref|YP_009406030.1| photosystem II protein M (plastid) [Lobelia stuhlmannii] ref|YP_009406835.1| photosystem II protein M (plastid) [Trematolobelia kauaiensis] ref|YP_009402870.1| photosystem II protein M (plastid) [Sclerotheca longistigmata] ref|YP_009402959.1| photosystem II protein M (plastid) [Centropogon granulosus] ref|YP_009403049.1| photosystem II protein M (plastid) [Clermontia fauriei] ref|YP_009403139.1| photosystem II protein M (plastid) [Cyanea leptostegia] ref|YP_009403228.1| photosystem II protein M (plastid) [Dialypetalum floribundum] ref|YP_009403317.1| photosystem II protein M (plastid) [Diastatea micrantha] ref|YP_009403643.1| photosystem II protein M (plastid) [Hypsela tridens] ref|YP_009403801.1| photosystem II protein M (plastid) [Legenere valdiviana] ref|YP_009403970.1| photosystem II protein M (plastid) [Lobelia acrochila] ref|YP_009404060.1| photosystem II protein M (plastid) [Pratia angulata] ref|YP_009404330.1| photosystem II protein M (plastid) [Lobelia chinensis] ref|YP_009404420.1| photosystem II protein M (plastid) [Lobelia columnaris] ref|YP_009404509.1| photosystem II protein M (plastid) [Lobelia davidii] ref|YP_009404598.1| photosystem II protein M (plastid) [Lobelia doniana] ref|YP_009404688.1| photosystem II protein M (plastid) [Lobelia gibberoa] ref|YP_009404867.1| photosystem II protein M (plastid) [Lobelia lukwangulensis] ref|YP_009404957.1| photosystem II protein M (plastid) [Lobelia melliana] ref|YP_009405046.1| photosystem II protein M (plastid) [Lobelia mildbraedii] ref|YP_009405135.1| photosystem II protein M (plastid) [Lobelia muscoides] ref|YP_009405224.1| photosystem II protein M (plastid) [Lobelia niihauensis] ref|YP_009405314.1| photosystem II protein M (plastid) [Pratia nummularia] ref|YP_009405404.1| photosystem II protein M (plastid) [Lobelia organensis] ref|YP_009405494.1| photosystem II protein M (plastid) [Lobelia petiolata] ref|YP_009405584.1| photosystem II protein M (plastid) [Lobelia rhynchopetalum] ref|YP_009405673.1| photosystem II protein M (plastid) [Lobelia ritabeaniana] ref|YP_009405762.1| photosystem II protein M (plastid) [Lobelia sancta] ref|YP_009405851.1| photosystem II protein M (plastid) [Lobelia seguinii] ref|YP_009405940.1| photosystem II protein M (plastid) [Lobelia sessilifolia] ref|YP_009406120.1| photosystem II protein M (plastid) [Lobelia telekii] ref|YP_009406210.1| photosystem II protein M (plastid) [Lobelia thapsoidea] ref|YP_009406299.1| photosystem II protein M (plastid) [Lobelia udzungwensis] ref|YP_009406388.1| photosystem II protein M (plastid) [Lobelia urens] ref|YP_009406478.1| photosystem II protein M (plastid) [Lobelia wollastonii] ref|YP_009406567.1| photosystem II protein M (plastid) [Lobelia yuccoides] ref|YP_009406657.1| photosystem II protein M (plastid) [Sclerotheca viridiflora] ref|YP_009406746.1| photosystem II protein M (plastid) [Solenopsis bivonae] ref|YP_009400081.1| photosystem II protein M (chloroplast) [Sinapis arvensis] ref|YP_009409716.1| photosystem II protein M (chloroplast) [Morettia canescens] ref|YP_009409629.1| photosystem II protein M (chloroplast) [Lobularia libyca] ref|YP_009414729.1| photosystem II protein M (chloroplast) [Platycodon grandiflorus] ref|YP_009416937.1| photosystem II protein M (chloroplast) [Hydrangea luteovenosa] ref|YP_009422218.1| photosystem II protein M (chloroplast) [Siphocampylus krauseanus] ref|YP_009422305.1| photosystem II protein M (chloroplast) [Centropogon nigricans] ref|YP_009422392.1| photosystem II protein M (chloroplast) [Burmeistera sodiroana] ref|YP_009422479.1| photosystem II protein M (chloroplast) [Burmeistera smaragdi] ref|YP_009422566.1| photosystem II protein M (chloroplast) [Burmeistera rubrosepala] ref|YP_009422653.1| photosystem II protein M (chloroplast) [Burmeistera resupinata] ref|YP_009422740.1| photosystem II protein M (chloroplast) [Burmeistera pirrensis] ref|YP_009422827.1| photosystem II protein M (chloroplast) [Burmeistera parviflora] ref|YP_009422914.1| photosystem II protein M (chloroplast) [Burmeistera oyacachensis] ref|YP_009423001.1| photosystem II protein M (chloroplast) [Burmeistera lutosa] ref|YP_009423088.1| photosystem II protein M (chloroplast) [Burmeistera loejtnantii] ref|YP_009423175.1| photosystem II protein M (chloroplast) [Burmeistera fuscoapicata] ref|YP_009423262.1| photosystem II protein M (chloroplast) [Burmeistera domingensis] ref|YP_009423349.1| photosystem II protein M (chloroplast) [Burmeistera cylindrocarpa] ref|YP_009423436.1| photosystem II protein M (chloroplast) [Burmeistera cyclostigmata] ref|YP_009423523.1| photosystem II protein M (chloroplast) [Burmeistera crispiloba] ref|YP_009423610.1| photosystem II protein M (chloroplast) [Burmeistera ceratocarpa] ref|YP_009423697.1| photosystem II protein M (chloroplast) [Burmeistera borjensis] ref|YP_009423784.1| photosystem II protein M (chloroplast) [Burmeistera auriculata] ref|YP_009427896.1| photosystem II protein M (chloroplast) [Kingdonia uniflora] ref|YP_009433098.1| photosystem II protein M (chloroplast) [Vitis mustangensis] ref|YP_009428169.1| photosystem II protein M (chloroplast) [Vitis acerifolia] ref|YP_009434497.1| photosystem II protein M (chloroplast) [Bergenia scopulosa] ref|YP_009434797.1| photosystem II protein M (plastid) [Lobelia galpinii] ref|YP_009434879.1| photosystem II protein M (plastid) [Lobelia hartlaubii] ref|YP_009434966.1| photosystem II protein M (plastid) [Lobelia holstii] ref|YP_009435034.1| photosystem II protein M (plastid) [Lobelia laxa] ref|YP_009435127.1| photosystem II protein M (plastid) [Lobelia linearis] ref|YP_009435237.1| photosystem II protein M (plastid) [Lobelia malowensis] ref|YP_009435324.1| photosystem II protein M (plastid) [Lobelia patula] ref|YP_009435397.1| photosystem II protein M (plastid) [Lobelia puberula] ref|YP_009435497.1| photosystem II protein M (plastid) [Lobelia sonderiana] ref|YP_009435584.1| photosystem II protein M (plastid) [Lobelia spicata] ref|YP_009435663.1| photosystem II protein M (plastid) [Lobelia thermalis] ref|YP_009435746.1| photosystem II protein M (plastid) [Monopsis alba] ref|YP_009435835.1| photosystem II protein M (plastid) [Monopsis flava] ref|YP_009436048.1| photosystem II protein M (plastid) [Lobelia physaloides] ref|YP_009436138.1| photosystem II protein M (plastid) [Cyphia angustiloba] ref|YP_009436224.1| photosystem II protein M (plastid) [Cyphia banksiana] ref|YP_009436337.1| photosystem II protein M (plastid) [Cyphia belfastica] ref|YP_009436414.1| photosystem II protein M (plastid) [Cyphia crenata] ref|YP_009436530.1| photosystem II protein M (plastid) [Cyphia dentariifolia] ref|YP_009436630.1| photosystem II protein M (plastid) [Cyphia glandulifera] ref|YP_009436710.1| photosystem II protein M (plastid) [Cyphia phyteuma] ref|YP_009436825.1| photosystem II protein M (plastid) [Cyphia schlechteri] ref|YP_009436936.1| photosystem II protein M (plastid) [Cyphia tortilis] ref|YP_009437013.1| photosystem II protein M (plastid) [Grammatotheca bergiana] ref|YP_009437124.1| photosystem II protein M (plastid) [Lobelia baumannii] ref|YP_009437198.1| photosystem II protein M (plastid) [Lobelia cardinalis] ref|YP_009437281.1| photosystem II protein M (plastid) [Lobelia erinus] ref|YP_009437756.1| photosystem II protein M (chloroplast) [Vitis x champinii] ref|YP_009441143.1| photosystem II reaction center M protein (chloroplast) [Adenophora erecta] ref|YP_009442100.1| photosystem II protein M (chloroplast) [Emmenopterys henryi] ref|YP_009442499.1| photosystem II reaction center M protein (chloroplast) [Codonopsis minima] ref|YP_009442899.1| photosystem II protein M (chloroplast) [Vitis cinerea] ref|YP_009444209.1| photosystem II protein M (chloroplast) [Vitis coignetiae] ref|YP_009446066.1| photosystem II protein M (chloroplast) [Coptis chinensis] ref|YP_009447640.1| photosystem II protein M (chloroplast) [Vitis cordifolia] ref|YP_009447726.1| photosystem II protein M (chloroplast) [Vitis ficifolia] ref|YP_009455583.1| photosystem II protein M (chloroplast) [Vitis rupestris] ref|YP_009456461.1| photosystem II protein M (chloroplast) [Gymnocarpos przewalskii] ref|YP_009458019.1| PsbM (chloroplast) [Dendrosenecio keniodendron] ref|YP_009458108.1| PsbM (chloroplast) [Dendrosenecio keniensis] ref|YP_009458196.1| PsbM (chloroplast) [Dendrosenecio battiscombei] ref|YP_009458454.1| PSII low MW protein (chloroplast) [Brachypodium hybridum] ref|YP_009458536.1| PSII low MW protein (chloroplast) [Brachypodium stacei] ref|YP_009462722.1| photosystem II protein M (chloroplast) [Tetragonia tetragonioides] ref|YP_009468090.1| photosystem II protein M (chloroplast) [Connorochloa tenuis] sp|Q56P14.1|PSBM_LACSA RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A0A329.1|PSBM_COFAR RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|Q0ZJ26.1|PSBM_VITVI RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QK12.1|PSBM_ARAHI RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QL13.1|PSBM_DRANE RecName: Full=Photosystem II reaction center protein M; Short=PSII-M sp|A4QLI8.1|PSBM_LOBMA RecName: Full=Photosystem II reaction center protein M; Short=PSII-M gb|AAX58141.1| PSII M protein (chloroplast) [Lactuca sativa] dbj|BAE47580.1| photosystem II reaction center M protein (chloroplast) [Lactuca sativa] gb|ABD47219.1| photosystem II protein M (chloroplast) [Lactuca sativa] gb|ABE47528.1| photosystem II protein M (chloroplast) [Vitis vinifera] gb|ABJ89673.1| photosystem II protein M (chloroplast) [Coffea arabica] dbj|BAF50017.1| PSII low MW protein (chloroplast) [Arabis hirsuta] dbj|BAF50368.1| PSII low MW protein (chloroplast) [Draba nemorosa] dbj|BAF50543.1| PSII low MW protein (chloroplast) [Lobularia maritima] gb|ABU85654.1| photosystem II protein M, partial (chloroplast) [Trachelium caeruleum] gb|ABV26507.1| photosystem II protein M (chloroplast) [Trachelium caeruleum] gb|ACF08629.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] gb|ACY66272.1| photosystem II protein M (chloroplast) [Brassica napus] gb|ADD30435.1| photosystem II protein M (chloroplast) [Heuchera sanguinea] gb|ADO15397.1| photosystem II protein M (chloroplast) [Jacobaea vulgaris] gb|ADW94825.1| PsbM (plastid) [Streptocarpus montigena] gb|ADW94827.1| PsbM (plastid) [Streptocarpus montigena] gb|ADW94829.1| PsbM (plastid) [Streptocarpus montigena] gb|ADW94831.1| PsbM (plastid) [Streptocarpus montigena] gb|AEX99264.1| PsbM (chloroplast) [Chrysanthemum indicum] gb|AEX99500.1| photosystem II M protein (chloroplast) [Chrysanthemum indicum] gb|AFA26834.1| photosystem II protein M (plastid) [Abolboda macrostachya] gb|AFA26848.1| photosystem II protein M, partial (plastid) [Flagellaria indica] gb|AFA45260.1| photosystem II M protein (chloroplast) [Chrysanthemum x morifolium] gb|AFP98807.1| photosystem II reaction center M protein (chloroplast) [Artemisia frigida] gb|AFQ99056.1| photosystem II protein M (chloroplast) [Sedum sarmentosum] gb|AGQ50345.1| photosystem II protein M (chloroplast) [Rumex acetosa] gb|AGW97095.1| photosystem II protein M (chloroplast) [Ipomoea dumetorum] dbj|BAO01486.1| photosystem II protein M (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01570.1| photosystem II protein M (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01654.1| photosystem II protein M (chloroplast) [Vitis vinifera subsp. caucasica] gb|AGZ13345.1| photosystem II protein M (chloroplast) [Haloxylon ammodendron] gb|AGZ13430.1| photosystem II protein M (chloroplast) [Haloxylon persicum] gb|AGZ17919.1| photosystem II protein M (chloroplast) [Agrostemma githago] emb|CCW28173.1| psbM protein (chloroplast) [Arabis alpina] gb|AHJ61131.1| photosystem II reaction center M protein (chloroplast) [Artemisia montana] gb|AHJ91203.1| photosystem II protein M (chloroplast) [Vitis rotundifolia] gb|AHX80445.1| photosystem II protein M (plastid) [Paris verticillata] gb|AHY80535.1| photosystem II protein M (plastid) [Beta vulgaris subsp. vulgaris] gb|AHY94446.1| photosystem II reaction center M protein (chloroplast) [Hanabusaya asiatica] gb|AHZ43052.1| photosystem II protein M (chloroplast) [Goodyera fumata] gb|AIE42460.1| photosystem II protein M (chloroplast) [Raphanus sativus] gb|AIK28998.1| photosystem II protein M (chloroplast) [Brassica napus] gb|AIM53772.1| photosystem II protein M (plastid) [Zizania aquatica] gb|AIN75577.1| photosystem II protein M (chloroplast) [Campanula americana] gb|AIS35677.1| photosystem II protein M (chloroplast) [Mesembryanthemum crystallinum] gb|AIZ06074.1| photosystem II protein M (chloroplast) [Brassica napus] gb|AIZ76886.1| photosystem II protein M (chloroplast) [Zizania latifolia] gb|AJB98614.1| PsbM (chloroplast) [Artemisia argyi] gb|AJD00854.1| photosystem II reaction center M protein (chloroplast) [Campanula takesimana] gb|AJE74527.1| photosystem II protein M (plastid) [Lactuca ludoviciana] gb|AJE74983.1| photosystem II protein M (plastid) [Achillea millefolium] gb|AJE75211.1| photosystem II protein M (plastid) [Senecio integerrimus] gb|AJV88505.1| photosystem II protein M (chloroplast) [Campynema lineare] gb|AKD00083.1| photosystem II protein M (plastid) [Brassica napus] gb|AKE32206.1| photosystem II reaction center M protein (chloroplast) [Adenophora remotiflora] gb|AKH59826.1| photosystem II protein M (plastid) [Trillium cuneatum] gb|AKJ83675.1| photosystem II protein M (chloroplast) [Spathiphyllum kochii] gb|AKM97912.1| PsbM (chloroplast) [Brassica oleracea var. capitata] gb|AKP95045.1| photosystem II protein M (chloroplast) [Anoectochilus roxburghii] gb|AKU36903.1| photosystem II protein M (plastid) [Trillium maculatum] gb|AKU36984.1| photosystem II protein M (plastid) [Trillium tschonoskii] gb|AKZ23259.1| photosystem II protein M (plastid) [Ellisia nyctelea] gb|AKZ23278.1| photosystem II protein M (plastid) [Impatiens capensis] gb|AKZ23279.1| photosystem II protein M (plastid) [Comandra umbellata] gb|AKZ23283.1| photosystem II protein M (plastid) [Campanula rotundifolia] gb|ALB78414.1| photosystem II protein M (chloroplast) [Heuchera parviflora var. saurensis] gb|ALC75177.1| photosystem II protein M (chloroplast) [Osyris alba] gb|ALE65914.1| photosystem II protein M (chloroplast) [Pericallis hybrida] gb|ALG63283.1| photosystem II protein M (chloroplast) [Beta vulgaris subsp. vulgaris] gb|ALI30850.1| photosystem II protein M (plastid) [Brighamia insignis] gb|ALK26677.1| photosystem II protein M (chloroplast) [Brassica juncea] gb|ALL45464.1| PSII low MW protein (chloroplast) [Isatis tinctoria] gb|ALO71256.1| photosystem II protein M (chloroplast) [Ampelopsis glandulosa var. brevipedunculata] gb|ALP73112.1| photosystem II protein M (chloroplast) [Schrenkiella parvula] emb|CRN13133.1| photosystem II protein M (chloroplast) [Cochlearia borzaeana] emb|CRN13216.1| photosystem II protein M (chloroplast) [Cochlearia islandica] emb|CRN13299.1| photosystem II protein M (chloroplast) [Cochlearia pyrenaica] emb|CRN13382.1| photosystem II protein M (chloroplast) [Cochlearia tridactylites] emb|CRN13465.1| photosystem II protein M (chloroplast) [Ionopsidium acaule] gb|ALV89919.1| photosystem II protein M (chloroplast) [Tetrastigma hemsleyanum] gb|AMA07283.1| photosystem II protein M (chloroplast) [Goodyera velutina] gb|AMB27128.1| photosystem II protein M (chloroplast) [Zizania latifolia] gb|AMD08694.1| photosystem II protein M (chloroplast) [Papaver somniferum] gb|AMD12011.1| photosystem II protein M (chloroplast) [Vitis aestivalis] gb|AML80398.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] gb|AML80544.1| photosystem II protein M (chloroplast) [Pedicularis ishidoyana] gb|AMR74021.1| photosystem II reaction center M protein (plastid) [Campanula punctata] gb|AMX21810.1| psbM (mitochondrion) [Dendrosenecio brassiciformis] gb|ANA07410.1| photosystem II protein M (chloroplast) [Coffea canephora] gb|AND76554.1| photosystem II protein M (chloroplast) [Paris polyphylla var. yunnanensis] gb|ANE10904.1| PsbM (chloroplast) [Brassica nigra] gb|ANJ04036.1| photosystem II protein M (chloroplast) [Pugionium dolabratum] gb|ANJ04121.1| photosystem II protein M (chloroplast) [Pugionium cornutum] gb|ANK36704.1| photosystem II protein M (chloroplast) [Sinapis arvensis] gb|ANN38926.1| PsbM (chloroplast) [Hydrangea serrata f. fertilis] gb|ANO44591.1| photosystem II protein M (chloroplast) [Amianthium muscitoxicum] gb|ANO44713.1| photosystem II protein M (chloroplast) [Calochortus albus] gb|ANO45128.1| photosystem II protein M (chloroplast) [Campynemanthe viridiflora] gb|ANO45422.1| photosystem II protein M (chloroplast) [Trillium luteum] gb|ANS11243.1| PsbM (chloroplast) [Artemisia fukudo] gb|ANS57980.1| PsbM (chloroplast) [Ligularia fischeri] gb|ANT45662.1| photosystem II protein M (chloroplast) [Isatis tinctoria] gb|ANW47862.1| PsbM (chloroplast) [Taraxacum officinale] gb|ANW83271.1| PsbM (plastid) [Brassica napus var. napus] gb|ANW83358.1| PsbM (plastid) [Brassica napus var. napus] gb|ANW83444.1| PsbM (plastid) [Brassica napus var. napus] gb|ANW83529.1| PsbM (plastid) [Brassica napus var. napus] gb|ANW83615.1| PsbM (plastid) [Brassica napus var. napus] gb|ANW83703.1| PsbM (plastid) [Brassica napus var. napus] gb|ANW83789.1| PsbM (plastid) [Brassica napus var. napus] gb|ANW83875.1| PsbM (plastid) [Brassica napus var. napus] gb|ANW83961.1| PsbM (plastid) [Brassica napus var. napus] gb|ANX10040.1| photosystem II protein M (chloroplast) [Cakile arabica] gb|ANX10295.1| photosystem II protein M (chloroplast) [Striga hermonthica] gb|AOG66067.1| photosystem II M protein (chloroplast) [Swertia mussotii] gb|AOP04292.1| photosystem II protein M (chloroplast) [Gentiana lawrencei var. farreri] gb|AOR52764.1| photosystem II protein M (chloroplast) [Vitis amurensis] gb|AOR82212.1| PsbM (chloroplast) [Taraxacum platycarpum] gb|AOR82299.1| PsbM (chloroplast) [Taraxacum mongolicum] gb|AOR82572.1| PsbM (chloroplast) [Artemisia gmelinii] gb|AOR82660.1| PsbM (chloroplast) [Artemisia capillaris] gb|AOV63658.1| photosystem II protein M (chloroplast) [Clermontia samuelii subsp. hanaensis] gb|AOV93787.1| photosystem II protein M (chloroplast) [Taraxacum sp. RHS-2016] gb|AOV93872.1| photosystem II protein M (chloroplast) [Taraxacum obtusifrons] gb|AOV93956.1| photosystem II protein M (chloroplast) [Taraxacum amplum] gb|APA33598.1| photosystem II protein M (chloroplast) [Taraxacum brevicorniculatum] gb|APA33680.1| photosystem II protein M (chloroplast) [Taraxacum kok-saghyz] gb|APA33762.1| photosystem II protein M (chloroplast) [Taraxacum officinale] gb|APD26336.1| photosystem II protein M (chloroplast) [Oxyria sinensis] gb|APM86084.1| photosystem II protein M (chloroplast) [Sinalliaria limprichtiana var. grandifolia] gb|APM86164.1| photosystem II protein M (chloroplast) [Sinalliaria limprichtiana] gb|APO08520.1| photosystem II protein M (chloroplast) [Orychophragmus violaceus] gb|APO09252.1| PSII low MW protein (chloroplast) [Megadenia pygmaea] gb|APQ38732.1| photosystem II protein M (plastid) [Cyanea fissa] gb|APQ38822.1| photosystem II protein M (plastid) [Delissea rhytidosperma] gb|APQ38912.1| photosystem II protein M (plastid) [Lithotoma petraea] gb|APQ38991.1| photosystem II protein M (plastid) [Lobelia anceps] gb|APQ39088.1| photosystem II protein M (plastid) [Lobelia boninensis] gb|APQ39178.1| photosystem II protein M (plastid) [Lobelia gregoriana subsp. sattimae] gb|APQ39268.1| photosystem II protein M (plastid) [Lobelia inflata] gb|APQ39357.1| photosystem II protein M (plastid) [Lobelia jasionoides] gb|APQ39447.1| photosystem II protein M (plastid) [Lobelia laxiflora] gb|APQ39536.1| photosystem II protein M (plastid) [Lobelia longisepala] gb|APQ39624.1| photosystem II protein M (plastid) [Lobelia morogoroensis] gb|APQ39713.1| photosystem II protein M (plastid) [Lobelia polyphylla] gb|APQ39803.1| photosystem II protein M (plastid) [Lobelia siphilitica var. siphilitica] gb|APQ39893.1| photosystem II protein M (plastid) [Lobelia stricklandiae] gb|APQ39983.1| photosystem II protein M (plastid) [Lobelia thuliniana] gb|APQ40135.1| photosystem II protein M (plastid) [Wimmerella hederacea] gb|APS85075.1| photosystem II protein M (chloroplast) [Orychophragmus sp. HH-2017b] gb|APS85160.1| photosystem II protein M (chloroplast) [Orychophragmus diffusus] gb|APS85245.1| photosystem II protein M (chloroplast) [Orychophragmus sp. HH-2017a] gb|APS85330.1| photosystem II protein M (chloroplast) [Orychophragmus taibaiensis] gb|APS85415.1| photosystem II protein M (chloroplast) [Orychophragmus hupehensis] gb|APS87339.1| photosystem II protein M (chloroplast) [Paris cronquistii] gb|APS87423.1| photosystem II protein M (chloroplast) [Paris dunniana] gb|APS87505.1| photosystem II protein M (chloroplast) [Paris fargesii] gb|APS87591.1| photosystem II protein M (chloroplast) [Paris fargesii] gb|APS87675.1| photosystem II protein M (chloroplast) [Paris luquanensis] gb|APS87759.1| photosystem II protein M (chloroplast) [Paris mairei] gb|APS87843.1| photosystem II protein M (chloroplast) [Paris marmorata] gb|APS88011.1| photosystem II protein M (chloroplast) [Paris polyphylla var. yunnanensis] gb|APS88095.1| photosystem II protein M (chloroplast) [Paris vietnamensis] gb|APS88181.1| photosystem II protein M (chloroplast) [Paris quadrifolia] dbj|BAW81307.1| photosystem II protein M (chloroplast) [Anoectochilus emeiensis] gb|AQS80559.1| photosystem II protein M (chloroplast) [Siphocampylus krauseanus] gb|AQS80646.1| photosystem II protein M (chloroplast) [Centropogon nigricans] gb|AQS80733.1| photosystem II protein M (chloroplast) [Burmeistera sodiroana] gb|AQS80820.1| photosystem II protein M (chloroplast) [Burmeistera smaragdi] gb|AQS80907.1| photosystem II protein M (chloroplast) [Burmeistera rubrosepala] gb|AQS80994.1| photosystem II protein M (chloroplast) [Burmeistera resupinata] gb|AQS81081.1| photosystem II protein M (chloroplast) [Burmeistera pirrensis] gb|AQS81168.1| photosystem II protein M (chloroplast) [Burmeistera parviflora] gb|AQS81255.1| photosystem II protein M (chloroplast) [Burmeistera oyacachensis] gb|AQS81342.1| photosystem II protein M (chloroplast) [Burmeistera lutosa] gb|AQS81429.1| photosystem II protein M (chloroplast) [Burmeistera loejtnantii] gb|AQS81516.1| photosystem II protein M (chloroplast) [Burmeistera fuscoapicata] gb|AQS81603.1| photosystem II protein M (chloroplast) [Burmeistera domingensis] gb|AQS81690.1| photosystem II protein M (chloroplast) [Burmeistera cylindrocarpa] gb|AQS81776.1| photosystem II protein M (chloroplast) [Burmeistera cyclostigmata] gb|AQS81864.1| photosystem II protein M (chloroplast) [Burmeistera crispiloba] gb|AQS81951.1| photosystem II protein M (chloroplast) [Burmeistera ceratocarpa] gb|AQS82038.1| photosystem II protein M (chloroplast) [Burmeistera borjensis] gb|AQS82125.1| photosystem II protein M (chloroplast) [Burmeistera auriculata] gb|AQV10256.1| PSII low MW protein (chloroplast) [Megacarpaea delavayi] gb|AQZ25185.1| PsbM (chloroplast) [Alyssum desertorum] gb|ARH02937.1| PsbM (chloroplast) [Diplostephium pulchrum] gb|ARH03022.1| PsbM (chloroplast) [Diplostephium sp. CAJ2] gb|ARH03192.1| PsbM (chloroplast) [Diplostephium jelskii] gb|ARH03362.1| PsbM (chloroplast) [Diplostephium cinerascens] gb|ARH03616.1| PsbM (chloroplast) [Diplostephium barclayanum] gb|ARH03701.1| PsbM (chloroplast) [Diplostephium glandulosum] gb|ARH03786.1| PsbM (chloroplast) [Diplostephium sp. CAJ2] gb|ARH03871.1| PsbM (chloroplast) [Diplostephium lechleri] gb|ARH04041.1| PsbM (chloroplast) [Diplostephium callilepis] gb|ARH04211.1| PsbM (chloroplast) [Diplostephium floribundum] gb|ARH04636.1| PsbM (chloroplast) [Diplostephium gynoxyoides] gb|ARH04806.1| PsbM (chloroplast) [Lagenophora cuchumatanica] gb|ARH04891.1| PsbM (chloroplast) [Diplostephium hartwegii] gb|ARH05146.1| PsbM (chloroplast) [Diplostephium juniperinum] gb|ARH05231.1| PsbM (chloroplast) [Diplostephium oxapampanum] gb|ARH05486.1| PsbM (chloroplast) [Diplostephium gnidioides] gb|ARH05911.1| PsbM (chloroplast) [Diplostephium ericoides] gb|ARH05996.1| PsbM (chloroplast) [Diplostephium haenkei] gb|ARH06081.1| PsbM (chloroplast) [Diplostephium cajamarquillense] gb|ARH06761.1| PsbM (chloroplast) [Diplostephium sp. CAJ2] gb|ARH06846.1| PsbM (chloroplast) [Diplostephium espinosae] gb|ARH06931.1| PsbM (chloroplast) [Diplostephium sp. CAJ2] gb|ARH07186.1| PsbM (chloroplast) [Diplostephium azureum] gb|ARH07356.1| PsbM (chloroplast) [Diplostephium foliosissimum] gb|ARH07611.1| PsbM (chloroplast) [Diplostephium cayambense] gb|ARH07951.1| PsbM (chloroplast) [Floscaldasia hypsophila] gb|ARH08036.1| PsbM (chloroplast) [Diplostephium spinulosum] gb|ARH08121.1| PsbM (chloroplast) [Diplostephium sp. CAJ2] gb|ARH08716.1| PsbM (chloroplast) [Diplostephium empetrifolium] gb|ARH09311.1| PsbM (chloroplast) [Diplostephium sagasteguii] gb|ARH09820.1| PsbM (chloroplast) [Diplostephium sp. CAJ2] gb|ARH09990.1| PsbM (chloroplast) [Diplostephium goodspeedii] gb|ARH10075.1| PsbM (chloroplast) [Diplostephium oblanceolatum] gb|ARH10160.1| PsbM (chloroplast) [Diplostephium pulchrum] gb|ARH10330.1| PsbM (chloroplast) [Diplostephium hippophae] gb|ARH10500.1| PsbM (chloroplast) [Diplostephium sp. CAJ2] gb|ARI46728.1| photosystem II protein M (chloroplast) [Arabis stelleri subsp. japonica] gb|ARJ60822.1| photosystem II reaction center M protein (plastid) [Artemisia annua] gb|ARJ62347.1| photosystem II protein M (plastid) [Mitragyna speciosa] gb|ARJ62432.1| photosystem II protein M (plastid) [Coffea arabica] gb|ARO35120.1| photosystem II reaction center M protein (chloroplast) [Adenophora erecta] gb|ARQ29957.1| photosystem II protein M (plastid) [Champereia manillana] gb|ARQ81408.1| PsbM (chloroplast) [Hydrangea serrata] gb|ARQ81494.1| PsbM (chloroplast) [Hydrangea serrata] gb|ARQ81580.1| PsbM (chloroplast) [Hydrangea serrata] gb|ARQ81666.1| PsbM (chloroplast) [Hydrangea serrata] gb|ARQ81752.1| PsbM (chloroplast) [Hydrangea petiolaris] gb|ARQ81840.1| PsbM (chloroplast) [Hydrangea hydrangeoides] gb|ARQ81928.1| PsbM (chloroplast) [Hydrangea serrata] gb|ARR27734.1| photosystem II protein M (chloroplast) [Platycodon grandiflorus] gb|ARU07796.1| PsbM (chloroplast) [Artemisia gmelinii] gb|ARU07884.1| PsbM (chloroplast) [Artemisia capillaris] dbj|BAX84085.1| photosystem II protein M (chloroplast) [Goodyera schlechtendaliana] dbj|BAX87996.1| photosystem II protein M (chloroplast) [Goodyera schlechtendaliana] gb|ARX96520.1| photosystem II protein M (chloroplast) [Coptis chinensis] gb|ASA34063.1| photosystem II protein M (plastid) [Sclerotheca longistigmata] gb|ASA34152.1| photosystem II protein M (plastid) [Centropogon granulosus] gb|ASA34242.1| photosystem II protein M (plastid) [Clermontia fauriei] gb|ASA34332.1| photosystem II protein M (plastid) [Cyanea leptostegia] gb|ASA34421.1| photosystem II protein M (plastid) [Dialypetalum floribundum] gb|ASA34510.1| photosystem II protein M (plastid) [Diastatea micrantha] gb|ASA34746.1| photosystem II protein M (plastid) [Hippobroma longiflora] gb|ASA34836.1| photosystem II protein M (plastid) [Hypsela tridens] gb|ASA35067.1| photosystem II protein M (plastid) [Legenere valdiviana] gb|ASA35236.1| photosystem II protein M (plastid) [Lobelia acrochila] gb|ASA35326.1| photosystem II protein M (plastid) [Pratia angulata] gb|ASA35506.1| photosystem II protein M (plastid) [Lobelia bequaertii] gb|ASA35595.1| photosystem II protein M (plastid) [Lobelia burttii subsp. burttii] gb|ASA35685.1| photosystem II protein M (plastid) [Lobelia burttii subsp. meruensis] gb|ASA35775.1| photosystem II protein M (plastid) [Lobelia burttii subsp. telmaticola] gb|ASA35865.1| photosystem II protein M (plastid) [Lobelia chinensis] gb|ASA35955.1| photosystem II protein M (plastid) [Lobelia columnaris] gb|ASA36045.1| photosystem II protein M (plastid) [Lobelia columnaris] gb|ASA36134.1| photosystem II protein M (plastid) [Lobelia davidii] gb|ASA36224.1| photosystem II protein M (plastid) [Lobelia deckenii subsp. deckenii] gb|ASA36314.1| photosystem II protein M (plastid) [Lobelia deckenii subsp. incipiens] gb|ASA36403.1| photosystem II protein M (plastid) [Lobelia doniana] gb|ASA36493.1| photosystem II protein M (plastid) [Lobelia gibberoa] gb|ASA36583.1| photosystem II protein M (plastid) [Lobelia gregoriana subsp. elgonensis] gb|ASA36673.1| photosystem II protein M (plastid) [Lobelia gregoriana subsp. gregoriana] gb|ASA36762.1| photosystem II protein M (plastid) [Lobelia kauaensis] gb|ASA36852.1| photosystem II protein M (plastid) [Lobelia lukwangulensis] gb|ASA36942.1| photosystem II protein M (plastid) [Lobelia melliana] gb|ASA37031.1| photosystem II protein M (plastid) [Lobelia mildbraedii] gb|ASA37121.1| photosystem II protein M (plastid) [Lobelia montana] gb|ASA37210.1| photosystem II protein M (plastid) [Lobelia muscoides] gb|ASA37299.1| photosystem II protein M (plastid) [Lobelia niihauensis] gb|ASA37389.1| photosystem II protein M (plastid) [Pratia nummularia] gb|ASA37479.1| photosystem II protein M (plastid) [Lobelia organensis] gb|ASA37569.1| photosystem II protein M (plastid) [Lobelia petiolata] gb|ASA37659.1| photosystem II protein M (plastid) [Lobelia rhynchopetalum] gb|ASA37748.1| photosystem II protein M (plastid) [Lobelia ritabeaniana] gb|ASA37837.1| photosystem II protein M (plastid) [Lobelia sancta] gb|ASA37926.1| photosystem II protein M (plastid) [Lobelia seguinii] gb|ASA38015.1| photosystem II protein M (plastid) [Lobelia sessilifolia] gb|ASA38194.1| photosystem II protein M (plastid) [Lobelia sp. 2 EBK-2017] gb|ASA38284.1| photosystem II protein M (plastid) [Lobelia sp. 3 EBK-2017] gb|ASA38372.1| photosystem II protein M (plastid) [Lobelia sp. RBGK8504378] gb|ASA38462.1| photosystem II protein M (plastid) [Lobelia stuhlmannii] gb|ASA38552.1| photosystem II protein M (plastid) [Lobelia telekii] gb|ASA38642.1| photosystem II protein M (plastid) [Lobelia thapsoidea] gb|ASA38731.1| photosystem II protein M (plastid) [Lobelia udzungwensis] gb|ASA38820.1| photosystem II protein M (plastid) [Lobelia urens] gb|ASA38910.1| photosystem II protein M (plastid) [Lobelia wollastonii] gb|ASA38999.1| photosystem II protein M (plastid) [Lobelia yuccoides] gb|ASA39088.1| photosystem II protein M (plastid) [Palmerella debilis subsp. serrata] gb|ASA39178.1| photosystem II protein M (plastid) [Sclerotheca viridiflora] gb|ASA39267.1| photosystem II protein M (plastid) [Solenopsis bivonae] gb|ASA39356.1| photosystem II protein M (plastid) [Trematolobelia kauaiensis] gb|ASD40852.1| photosystem II protein M (chloroplast) [Dasypyrum villosum] gb|ASD40931.1| photosystem II protein M (chloroplast) [Dasypyrum villosum] gb|ASD41009.1| photosystem II protein M (chloroplast) [Dasypyrum villosum] gb|ASD42390.1| photosystem II protein M (chloroplast) [Heteranthelium piliferum] gb|ASD43396.1| photosystem II protein M (chloroplast) [Elymus cognatus] gb|ASD43474.1| photosystem II protein M (chloroplast) [Pseudoroegneria spicata] gb|ASD43548.1| photosystem II protein M (chloroplast) [Pseudoroegneria spicata] gb|ASD43698.1| photosystem II protein M (chloroplast) [Elymus stipifolius] gb|ASD43984.1| photosystem II protein M (chloroplast) [Pseudoroegneria strigosa] gb|ASD44142.1| photosystem II protein M (chloroplast) [Pseudoroegneria strigosa] gb|ASD44294.1| photosystem II protein M (chloroplast) [Elymus tauri] gb|ASD44441.1| photosystem II protein M (chloroplast) [Elymus tauri] gb|ASD45529.1| photosystem II protein M (chloroplast) [Thinopyrum bessarabicum] gb|ASD45607.1| photosystem II protein M (chloroplast) [Thinopyrum distichum] gb|ASD45758.1| photosystem II protein M (chloroplast) [Thinopyrum elongatum] gb|ASI13283.1| photosystem II protein M (chloroplast) [Brachypodium pinnatum] gb|ASJ64035.1| photosystem II protein M (chloroplast) [Anastatica hierochuntica] gb|ASJ64207.1| photosystem II protein M (chloroplast) [Dontostemon micranthus] gb|ASJ64376.1| photosystem II protein M (chloroplast) [Farsetia stylosa] gb|ASJ64711.1| photosystem II protein M (chloroplast) [Lobularia libyca] gb|ASJ64882.1| photosystem II protein M (chloroplast) [Morettia canescens] gb|ASM41920.1| photosystem II protein M (chloroplast) [Alyssum montanum subsp. gmelinii] gb|AST10068.1| photosystem II protein M (chloroplast) [Hydrangea luteovenosa] gb|ASU96406.1| photosystem II protein M (chloroplast) [Lasthenia californica] gb|ASV47772.1| photosystem II protein M (chloroplast) [Kingdonia uniflora] dbj|BBA26342.1| photosystem II protein M (chloroplast) [Vitis acerifolia] dbj|BBA27149.1| photosystem II protein M (chloroplast) [Vitis aestivalis] dbj|BBA31531.1| photosystem II protein M (chloroplast) [Vitis amurensis] gb|ASY93356.1| PsbM (chloroplast) [Brassica rapa] gb|ASY93443.1| PsbM (chloroplast) [Brassica rapa subsp. chinensis] gb|ASY93530.1| PsbM (chloroplast) [Brassica rapa subsp. pekinensis] gb|ASY93617.1| PsbM (chloroplast) [Brassica rapa subsp. rapa] gb|ASY93704.1| PsbM (chloroplast) [Brassica nigra] gb|ASY93791.1| PsbM (chloroplast) [Brassica nigra] gb|ASY93878.1| PsbM (chloroplast) [Brassica nigra] gb|ASY93965.1| PsbM (chloroplast) [Brassica oleracea var. capitata] gb|ASY94052.1| PsbM (chloroplast) [Brassica oleracea var. botrytis] gb|ASY94139.1| PsbM (chloroplast) [Brassica oleracea var. gongylodes] gb|ASY94226.1| PsbM (chloroplast) [Brassica oleracea var. italica] gb|ASY94313.1| PsbM (chloroplast) [Raphanus raphanistrum subsp. landra] gb|ASY94400.1| PsbM (chloroplast) [Raphanus sativus var. raphanistroides] gb|ASY94487.1| PsbM (chloroplast) [Raphanus sativus var. sativus] gb|ASY94574.1| PsbM (chloroplast) [Raphanus sativus var. sativus] gb|ASY94661.1| PsbM (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY94748.1| PsbM (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY94835.1| PsbM (chloroplast) [Brassica juncea] gb|ASY94922.1| PsbM (chloroplast) [Brassica juncea subsp. integrifolia] gb|ASY95009.1| PsbM (chloroplast) [Brassica napus] gb|ASY95096.1| PsbM (chloroplast) [Brassica napus var. napus] gb|ASY95183.1| PsbM (chloroplast) [Brassica napus var. napus] gb|ASY95270.1| PsbM (chloroplast) [Brassica napus var. napus] gb|ASY95357.1| PsbM (chloroplast) [Brassica carinata] gb|ASY95444.1| PsbM (chloroplast) [Brassica carinata] gb|ASY95531.1| PsbM (chloroplast) [Brassica carinata] gb|ASY95618.1| PsbM (chloroplast) [Brassica carinata] dbj|BBA46190.1| photosystem II protein M (chloroplast) [Vitis cinerea var. helleri] dbj|BBA53914.1| photosystem II protein M (chloroplast) [Vitis mustangensis] gb|ATE89545.1| photosystem II protein M (chloroplast) [Bergenia scopulosa] gb|ATG24584.1| photosystem II protein M (plastid) [Lobelia fervens subsp. fervens] gb|ATG24704.1| photosystem II protein M (plastid) [Lobelia galpinii] gb|ATG24787.1| photosystem II protein M (plastid) [Lobelia hartlaubii] gb|ATG24881.1| photosystem II protein M (plastid) [Lobelia heterophylla subsp. heterophylla] gb|ATG24968.1| photosystem II protein M (plastid) [Lobelia holstii] gb|ATG25036.1| photosystem II protein M (plastid) [Lobelia laxa] gb|ATG25129.1| photosystem II protein M (plastid) [Lobelia linearis] gb|ATG25239.1| photosystem II protein M (plastid) [Lobelia malowensis] gb|ATG25326.1| photosystem II protein M (plastid) [Lobelia patula] gb|ATG25399.1| photosystem II protein M (plastid) [Lobelia puberula] gb|ATG25499.1| photosystem II protein M (plastid) [Lobelia sonderiana] gb|ATG25585.1| photosystem II protein M (plastid) [Lobelia spicata] gb|ATG25665.1| photosystem II protein M (plastid) [Lobelia thermalis] gb|ATG25748.1| photosystem II protein M (plastid) [Monopsis alba] gb|ATG25838.1| photosystem II protein M (plastid) [Monopsis debilis var. debilis] gb|ATG25926.1| photosystem II protein M (plastid) [Monopsis flava] gb|ATG26052.1| photosystem II protein M (plastid) [Monopsis stellarioides subsp. schimperiana] gb|ATG26225.1| photosystem II protein M (plastid) [Lobelia physaloides] gb|ATG26315.1| photosystem II protein M (plastid) [Cyphia angustiloba] gb|ATG26402.1| photosystem II protein M (plastid) [Cyphia banksiana] gb|ATG26514.1| photosystem II protein M (plastid) [Cyphia belfastica] gb|ATG26608.1| photosystem II protein M (plastid) [Cyphia bulbosa var. bulbosa] gb|ATG26690.1| photosystem II protein M (plastid) [Cyphia crenata] gb|ATG26805.1| photosystem II protein M (plastid) [Cyphia dentariifolia] gb|ATG26886.1| photosystem II protein M (plastid) [Cyphia elata var. gerrardii] gb|ATG27005.1| photosystem II protein M (plastid) [Cyphia glandulifera] gb|ATG27086.1| photosystem II protein M (plastid) [Cyphia phyteuma] gb|ATG27200.1| photosystem II protein M (plastid) [Cyphia schlechteri] gb|ATG27311.1| photosystem II protein M (plastid) [Cyphia tortilis] gb|ATG27389.1| photosystem II protein M (plastid) [Grammatotheca bergiana] gb|ATG27501.1| photosystem II protein M (plastid) [Lobelia baumannii] gb|ATG27574.1| photosystem II protein M (plastid) [Lobelia cardinalis] gb|ATG27657.1| photosystem II protein M (plastid) [Lobelia erinus] dbj|BBA54783.1| photosystem II protein M (chloroplast) [Vitis x champinii] gb|ATL16558.1| photosystem II protein M (chloroplast) [Artemisia princeps] gb|ATL16620.1| photosystem II protein M (chloroplast) [Artemisia argyrophylla] gb|ATL16682.1| photosystem II protein M (chloroplast) [Artemisia montana] gb|ATL16879.1| photosystem II protein M (chloroplast) [Chrysanthemum zawadskii var. latilobum] gb|ATL16942.1| photosystem II protein M (chloroplast) [Chrysanthemum zawadskii subsp. coreanum] gb|ATL57824.1| PsbM (chloroplast) [Dendrosenecio keniodendron] gb|ATL57913.1| PsbM (chloroplast) [Dendrosenecio keniensis] gb|ATL58002.1| PsbM (chloroplast) [Dendrosenecio battiscombei] gb|ATN40366.1| photosystem II protein M (chloroplast) [Emmenopterys henryi] gb|ATO90178.1| photosystem II reaction center M protein (chloroplast) [Codonopsis minima] dbj|BBB03553.1| photosystem II protein M (chloroplast) [Vitis cinerea] dbj|BBB04572.1| photosystem II protein M (chloroplast) [Vitis coignetiae] gb|ATU84311.1| photosystem II protein M (chloroplast) [Artemisia annua] dbj|BBB35970.1| photosystem II protein M (chloroplast) [Vitis cordifolia] dbj|BBB38400.1| photosystem II protein M (chloroplast) [Vitis ficifolia] gb|AUF33349.1| PsbM (chloroplast) [Hydrangea aspera] gb|AUF33519.1| PsbM (chloroplast) [Hydrangea heteromalla] dbj|BBB55956.1| photosystem II protein M (chloroplast) [Vitis flexuosa] dbj|BBB94360.1| psbM (chloroplast) [Vitis monticola] dbj|BBC14949.1| photosystem II protein M (chloroplast) [Vitis rupestris] gb|AUJ23051.1| photosystem II protein M (chloroplast) [Gymnocarpos przewalskii] emb|CZT22472.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|CZT22555.1| PSII low MW protein (chloroplast) [Brachypodium hybridum] emb|SAP09118.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09198.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09280.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09364.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09448.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09532.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09616.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09699.1| PSII low MW protein (chloroplast) [Brachypodium stacei] emb|SAP09783.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09867.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP09951.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10034.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10118.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10202.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10285.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10369.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10453.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10537.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10621.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10705.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10789.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10872.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP10956.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11039.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11121.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11204.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11288.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11371.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11455.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11539.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11623.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11705.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11788.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11872.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP11956.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12040.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12124.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12208.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12291.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12374.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12457.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12540.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12622.1| PSII low MW protein (chloroplast) [Brachypodium hybridum] emb|SAP12706.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12790.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12874.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP12958.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP13042.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP13126.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP13210.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP13291.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP13375.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP13459.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP13543.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] emb|SAP13627.1| PSII low MW protein (chloroplast) [Brachypodium distachyon] gb|AUT83215.1| photosystem II reaction center M protein (plastid) [Campanula rapunculoides] gb|AUT83276.1| photosystem II reaction center M protein (plastid) [Campanula rotundifolia] gb|AUV65203.1| photosystem II protein M (chloroplast) [Tetragonia tetragonioides] gb|AVA08367.1| photosystem II protein M (chloroplast) [Connorochloa tenuis] gb|AVI25895.1| photosystem II M protein (chloroplast) [Chrysanthemum boreale] gb|AVI69777.1| PsbM (chloroplast) [Hydrocera triflora] gb|AVI69866.1| PsbM (chloroplast) [Impatiens piufanensis] gb|AVK39692.1| photosystem II protein M (chloroplast) [Hancornia speciosa] dbj|BBC42832.1| photosystem II protein M (chloroplast) [Arabis hirsuta var. nipponica] dbj|BBC42918.1| photosystem II protein M (chloroplast) [Arabis hirsuta] dbj|BBC43004.1| photosystem II protein M (chloroplast) [Arabis flagellosa] Length = 34 Score = 66.6 bits (161), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >ref|YP_009373817.1| PsbM (chloroplast) [Soliva sessilis] gb|ARH03447.1| PsbM (chloroplast) [Soliva sessilis] Length = 35 Score = 66.6 bits (161), Expect = 5e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >ref|YP_009404150.1| photosystem II protein M (plastid) [Lobelia bambuseti] gb|ASA35416.1| photosystem II protein M (plastid) [Lobelia bambuseti] Length = 37 Score = 66.6 bits (161), Expect = 6e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >ref|YP_009403880.1| photosystem II protein M (plastid) [Lobelia aberdarica] gb|ASA35146.1| photosystem II protein M (plastid) [Lobelia aberdarica] Length = 37 Score = 66.6 bits (161), Expect = 6e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >ref|YP_009145255.1| photosystem II protein M (plastid) [Trillium decumbens] gb|AKK32133.1| photosystem II protein M (plastid) [Trillium decumbens] Length = 37 Score = 66.6 bits (161), Expect = 6e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >gb|ATL76538.1| photosystem II protein M (plastid) [Chenopodium album] Length = 39 Score = 66.6 bits (161), Expect = 6e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN*LITLNET 201 MEVNILAFIATALFILVPTAFLLIIYVKTVSQ +I LNET Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTVSQ---MINLNET 39 >ref|YP_009262745.1| photosystem II protein M (chloroplast) [Ludisia discolor] gb|ANI87410.1| photosystem II protein M (chloroplast) [Ludisia discolor] Length = 34 Score = 66.2 bits (160), Expect = 7e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 ME+NILAFIATALFILVPTAFLLIIYVKTVSQNN Sbjct: 1 MEINILAFIATALFILVPTAFLLIIYVKTVSQNN 34 >ref|YP_009154945.1| photosystem II M protein (chloroplast) [Gentiana straminea] ref|YP_009155030.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] ref|YP_009155860.1| photosystem II protein M (plastid) [Stipa hymenoides] ref|YP_009156028.1| photosystem II protein M (plastid) [Ampelodesmos mauritanicus] ref|YP_009157112.1| photosystem II protein M (plastid) [Oryzopsis asperifolia] ref|YP_009157363.1| photosystem II protein M (plastid) [Phleum alpinum] ref|YP_009157447.1| photosystem II protein M (plastid) [Piptochaetium avenaceum] ref|YP_009175669.1| photosystem II protein M (chloroplast) [Eutrema salsugineum] ref|YP_009180558.1| photosystem II protein M (chloroplast) [Stipa lipskyi] ref|YP_009192782.1| photosystem II protein M (chloroplast) [Eutrema yunnanense] ref|YP_009192869.1| photosystem II protein M (chloroplast) [Eutrema heterophyllum] ref|YP_009232350.1| photosystem II protein M (chloroplast) [Eutrema halophilum] ref|YP_009232437.1| photosystem II protein M (chloroplast) [Eutrema botschantzevii] ref|YP_009232648.1| photosystem II protein M (chloroplast) [Stipa purpurea] ref|YP_009256989.1| photosystem II protein M (chloroplast) [Gentiana tibetica] ref|YP_009330685.1| photosystem II protein M (chloroplast) [Viburnum utile] ref|YP_009356347.1| photosystem II protein M (chloroplast) [Thlaspi arvense] ref|YP_009420152.1| photosystem II M protein (chloroplast) [Gentiana macrophylla] ref|YP_009451673.1| photosystem II protein M (chloroplast) [Nardus stricta] ref|YP_009451757.1| photosystem II protein M (chloroplast) [Nassella hyalina] ref|YP_009452014.1| photosystem II protein M (chloroplast) [Piptatherum songaricum] ref|YP_009464227.1| photosystem II protein M (plastid) [Stipa arabica] ref|YP_009464308.1| photosystem II protein M (plastid) [Stipa borysthenica] ref|YP_009464389.1| photosystem II protein M (plastid) [Stipa capillata] ref|YP_009464470.1| photosystem II protein M (plastid) [Stipa caucasica] ref|YP_009464551.1| photosystem II protein M (plastid) [Stipa hohenackeriana] ref|YP_009464632.1| photosystem II protein M (plastid) [Stipa jagnobica] ref|YP_009464713.1| photosystem II protein M (plastid) [Stipa lessingiana] ref|YP_009464794.1| photosystem II protein M (plastid) [Stipa magnifica] ref|YP_009464875.1| photosystem II protein M (plastid) [Stipa narynica] ref|YP_009464956.1| photosystem II protein M (plastid) [Stipa orientalis] ref|YP_009465037.1| photosystem II protein M (plastid) [Stipa ovczinnikovii] ref|YP_009465118.1| photosystem II protein M (plastid) [Stipa x alaica] ref|YP_009465199.1| photosystem II protein M (plastid) [Stipa x brevicallosa] ref|YP_009465280.1| photosystem II protein M (plastid) [Stipa zalesskii] ref|YP_009467924.1| photosystem II protein M (chloroplast) [Alopecurus arundinaceus] gb|AID57319.1| photosystem II M protein (chloroplast) [Gentiana straminea] gb|AID61129.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|AJV88767.1| photosystem II protein M (plastid) [Stipa hymenoides] gb|AJV88935.1| photosystem II protein M (plastid) [Ampelodesmos mauritanicus] gb|AJV90019.1| photosystem II protein M (plastid) [Oryzopsis asperifolia] gb|AJV90270.1| photosystem II protein M (plastid) [Phleum alpinum] gb|AJV90354.1| photosystem II protein M (plastid) [Piptochaetium avenaceum] gb|AKZ31612.1| cytochrome b6/f complex subunit VIII (chloroplast) [Gentiana robusta] gb|ALH16832.1| photosystem II protein M (chloroplast) [Eutrema salsugineum] gb|ALM03049.1| photosystem II protein M (chloroplast) [Stipa lipskyi] gb|ALP73209.1| photosystem II protein M (chloroplast) [Eutrema yunnanense] gb|ALP73286.1| photosystem II protein M (chloroplast) [Eutrema heterophyllum] gb|AMA21337.1| photosystem II protein M (chloroplast) [Eutrema halophilum] gb|AMA21424.1| photosystem II protein M (chloroplast) [Eutrema botschantzevii] gb|AMA97165.1| photosystem II protein M (chloroplast) [Stipa purpurea] gb|AMC31875.1| photosystem II protein M (chloroplast) [Chorispora tenella] gb|ANG07638.1| photosystem II protein M (chloroplast) [Gentiana tibetica] gb|APD79287.1| photosystem II protein M (chloroplast) [Viburnum utile] gb|AQV10435.1| photosystem II protein M (chloroplast) [Thlaspi arvense] gb|ARQ27987.1| photosystem II protein M (chloroplast) [Nardus stricta] gb|ARQ28071.1| photosystem II protein M (chloroplast) [Nassella hyalina] gb|ARQ28328.1| photosystem II protein M (chloroplast) [Piptatherum songaricum] gb|ARS43980.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|ARS44420.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|ARS44505.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|ARS44590.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|ARS44675.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|ARS44760.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|ARS44845.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|ARS44930.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis] gb|ARU80785.1| photosystem II protein M (chloroplast) [Agropyron cristatum] gb|ASD39635.1| photosystem II protein M (chloroplast) [Agropyron cristatum] gb|ASD39788.1| photosystem II protein M (chloroplast) [Agropyron cristatum] gb|ASD40401.1| photosystem II protein M (chloroplast) [Australopyrum retrofractum] gb|ASD41237.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis] gb|ASD41313.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis] gb|ASD41389.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis] gb|ASD41465.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis] gb|ASD41541.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis] gb|ASD41617.1| photosystem II protein M (chloroplast) [Eremopyrum triticeum] gb|ASD41693.1| photosystem II protein M (chloroplast) [Eremopyrum triticeum] gb|ASD41757.1| photosystem II protein M (chloroplast) [Eremopyrum triticeum] gb|ASD41844.1| photosystem II protein M (chloroplast) [Henrardia persica] gb|ASD41922.1| photosystem II protein M (chloroplast) [Henrardia persica] gb|ASD42079.1| photosystem II protein M (chloroplast) [Henrardia persica] gb|ASI00078.1| photosystem II protein M (chloroplast) [Agropyron cristatum] gb|ASI01001.1| photosystem II protein M (chloroplast) [Australopyrum retrofractum] gb|ASJ64634.1| photosystem II protein M (chloroplast) [Chorispora tenella] gb|ASO75683.1| photosystem II M protein (chloroplast) [Gentiana macrophylla] gb|ATL15497.1| photosystem II protein M (chloroplast) [Nassella neesiana] gb|ATL15581.1| photosystem II protein M (chloroplast) [Nassella hyalina] gb|AUZ21122.1| photosystem II protein M (plastid) [Stipa arabica] gb|AUZ21203.1| photosystem II protein M (plastid) [Stipa borysthenica] gb|AUZ21284.1| photosystem II protein M (plastid) [Stipa capillata] gb|AUZ21365.1| photosystem II protein M (plastid) [Stipa capillata] gb|AUZ21446.1| photosystem II protein M (plastid) [Stipa caucasica] gb|AUZ21527.1| photosystem II protein M (plastid) [Stipa caucasica] gb|AUZ21608.1| photosystem II protein M (plastid) [Stipa caucasica subsp. glareosa] gb|AUZ21689.1| photosystem II protein M (plastid) [Stipa hohenackeriana] gb|AUZ21770.1| photosystem II protein M (plastid) [Stipa jagnobica] gb|AUZ21851.1| photosystem II protein M (plastid) [Stipa lessingiana] gb|AUZ21932.1| photosystem II protein M (plastid) [Stipa magnifica] gb|AUZ22013.1| photosystem II protein M (plastid) [Stipa narynica] gb|AUZ22094.1| photosystem II protein M (plastid) [Stipa orientalis] gb|AUZ22175.1| photosystem II protein M (plastid) [Stipa ovczinnikovii] gb|AUZ22256.1| photosystem II protein M (plastid) [Stipa pennata subsp. ceynowae] gb|AUZ22337.1| photosystem II protein M (plastid) [Stipa pennata subsp. pennata] gb|AUZ22418.1| photosystem II protein M (plastid) [Stipa richteriana subsp. richteriana] gb|AUZ22498.1| photosystem II protein M (plastid) [Stipa tianschanica var. gobica] gb|AUZ22579.1| photosystem II protein M (plastid) [Stipa x alaica] gb|AUZ22660.1| photosystem II protein M (plastid) [Stipa x brevicallosa] gb|AUZ22741.1| photosystem II protein M (plastid) [Stipa zalesskii] gb|AVA08201.1| photosystem II protein M (chloroplast) [Alopecurus arundinaceus] Length = 34 Score = 66.2 bits (160), Expect = 7e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MEVNILAFIATALFIL+PTAFLLIIYVKTVSQNN Sbjct: 1 MEVNILAFIATALFILIPTAFLLIIYVKTVSQNN 34 >ref|YP_009108837.1| photosystem II protein M [Pentalinon luteum] ref|YP_009114229.1| photosystem II reaction center M protein (chloroplast) [Phedimus takesimensis] ref|YP_009164494.1| PsbM (chloroplast) [Sedum oryzifolium] gb|AHJ61225.1| photosystem II reaction center M protein (chloroplast) [Phedimus takesimensis] gb|AIW05683.1| photosystem II protein M (plastid) [Pentalinon luteum] gb|AIW05768.1| photosystem II protein M (plastid) [Periploca sepium] gb|AIW05853.1| photosystem II protein M (plastid) [Rhabdadenia biflora] gb|AJD00145.1| PsbM (chloroplast) [Sedum oryzifolium] Length = 34 Score = 66.2 bits (160), Expect = 7e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 326 MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 225 MEVNILAFIATALFILVPTAFLLIIYVKT+SQNN Sbjct: 1 MEVNILAFIATALFILVPTAFLLIIYVKTISQNN 34