BLASTX nr result
ID: Chrysanthemum22_contig00005085
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00005085 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY74655.1| hypothetical protein LSAT_5X78781 [Lactuca sativa] 65 8e-10 ref|XP_023732746.1| solute carrier family 25 member 44-like [Lac... 65 9e-10 ref|XP_021989718.1| solute carrier family 25 member 44-like [Hel... 64 2e-09 gb|OTG12455.1| putative substrate carrier protein [Helianthus an... 64 2e-09 gb|KVI01504.1| Mitochondrial carrier domain-containing protein [... 64 3e-09 ref|XP_021996912.1| solute carrier family 25 member 44-like [Hel... 63 5e-09 gb|KVI11473.1| Mitochondrial carrier domain-containing protein [... 63 9e-09 ref|XP_022016859.1| solute carrier family 25 member 44-like [Hel... 62 1e-08 ref|XP_017229128.1| PREDICTED: solute carrier family 25 member 4... 62 1e-08 ref|XP_022880344.1| solute carrier family 25 member 44-like [Ole... 62 2e-08 gb|EPS74614.1| hypothetical protein M569_00141, partial [Genlise... 61 3e-08 ref|XP_022860851.1| solute carrier family 25 member 44-like, par... 61 4e-08 ref|XP_011081632.2| solute carrier family 25 member 44 [Sesamum ... 60 9e-08 gb|PIN24002.1| putative mitochondrial carrier protein [Handroant... 60 9e-08 ref|XP_023736173.1| solute carrier family 25 member 44-like [Lac... 60 9e-08 ref|XP_001760564.1| predicted protein [Physcomitrella patens] >g... 59 1e-07 emb|CDP13443.1| unnamed protein product [Coffea canephora] 59 1e-07 gb|PHU01311.1| hypothetical protein BC332_31098 [Capsicum chinense] 59 2e-07 gb|PHT32631.1| hypothetical protein CQW23_28968 [Capsicum baccatum] 59 2e-07 ref|XP_016551577.1| PREDICTED: solute carrier family 25 member 4... 59 2e-07 >gb|PLY74655.1| hypothetical protein LSAT_5X78781 [Lactuca sativa] Length = 338 Score = 65.5 bits (158), Expect = 8e-10 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQGG+G + YNG IDAFR I Sbjct: 129 AAAGLSAAMAAQMVWTPIDVVSQRLMVQGGHGA-QIRYNGGIDAFRKI 175 >ref|XP_023732746.1| solute carrier family 25 member 44-like [Lactuca sativa] Length = 368 Score = 65.5 bits (158), Expect = 9e-10 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQGG+G + YNG IDAFR I Sbjct: 159 AAAGLSAAMAAQMVWTPIDVVSQRLMVQGGHGA-QIRYNGGIDAFRKI 205 >ref|XP_021989718.1| solute carrier family 25 member 44-like [Helianthus annuus] ref|XP_021989719.1| solute carrier family 25 member 44-like [Helianthus annuus] Length = 339 Score = 64.3 bits (155), Expect = 2e-09 Identities = 36/50 (72%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*T--MVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQGGN T + YNG IDAFR I Sbjct: 129 AAAGLSAAMAAQLVWTPIDVVSQRLMVQGGNTAHTGAVRYNGGIDAFRKI 178 >gb|OTG12455.1| putative substrate carrier protein [Helianthus annuus] Length = 353 Score = 64.3 bits (155), Expect = 2e-09 Identities = 36/50 (72%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*T--MVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQGGN T + YNG IDAFR I Sbjct: 129 AAAGLSAAMAAQLVWTPIDVVSQRLMVQGGNTAHTGAVRYNGGIDAFRKI 178 >gb|KVI01504.1| Mitochondrial carrier domain-containing protein [Cynara cardunculus var. scolymus] Length = 346 Score = 63.9 bits (154), Expect = 3e-09 Identities = 35/53 (66%), Positives = 37/53 (69%), Gaps = 5/53 (9%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMV-----YNGDIDAFRSI 256 AAAG++AAM Q VWTPIDV S RLMVQGGNG T V Y G IDAFR I Sbjct: 129 AAAGVTAAMAAQMVWTPIDVVSQRLMVQGGNGAKTTVSGAFKYTGGIDAFRKI 181 >ref|XP_021996912.1| solute carrier family 25 member 44-like [Helianthus annuus] gb|OTG04122.1| putative substrate carrier protein [Helianthus annuus] Length = 340 Score = 63.2 bits (152), Expect = 5e-09 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMVYNGDIDAFRSI 256 AAAG+SAAM Q VWTPIDV S RLMVQGGN + YNG +DAFR I Sbjct: 129 AAAGVSAAMAAQLVWTPIDVVSQRLMVQGGNS--AVRYNGGVDAFRKI 174 >gb|KVI11473.1| Mitochondrial carrier domain-containing protein [Cynara cardunculus var. scolymus] Length = 458 Score = 62.8 bits (151), Expect = 9e-09 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMVYNGDIDAFRSI 256 AAAGL+AAM Q VWTPIDV S RLMVQGG G +YNG IDAF+ I Sbjct: 258 AAAGLTAAMAAQLVWTPIDVVSQRLMVQGGKGG-AAIYNGGIDAFKRI 304 >ref|XP_022016859.1| solute carrier family 25 member 44-like [Helianthus annuus] gb|OTF91131.1| putative solute carrier family 25 member 44 [Helianthus annuus] Length = 326 Score = 62.0 bits (149), Expect = 1e-08 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMVYNGDIDAFRSI 256 A AGLSAAM Q VWTPIDV S RLMVQGG G +++YNG IDAF+ I Sbjct: 126 AVAGLSAAMASQLVWTPIDVVSQRLMVQGGKGG-SVMYNGGIDAFKRI 172 >ref|XP_017229128.1| PREDICTED: solute carrier family 25 member 44-like [Daucus carota subsp. sativus] gb|KZN11735.1| hypothetical protein DCAR_004391 [Daucus carota subsp. sativus] Length = 332 Score = 62.0 bits (149), Expect = 1e-08 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMV--YNGDIDAFRSI 256 AAAGLSAAMV Q VWTP+DV S RLMVQGG+ + + + Y+G IDAFR I Sbjct: 129 AAAGLSAAMVAQLVWTPVDVVSQRLMVQGGSNLSSAMVKYSGGIDAFRKI 178 >ref|XP_022880344.1| solute carrier family 25 member 44-like [Olea europaea var. sylvestris] Length = 356 Score = 61.6 bits (148), Expect = 2e-08 Identities = 34/51 (66%), Positives = 35/51 (68%), Gaps = 3/51 (5%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGN---GV*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQ GN + YNG IDAFR I Sbjct: 143 AAAGLSAAMAAQLVWTPIDVVSQRLMVQSGNNGGSIGLKTYNGGIDAFRKI 193 >gb|EPS74614.1| hypothetical protein M569_00141, partial [Genlisea aurea] Length = 330 Score = 60.8 bits (146), Expect = 3e-08 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTP+DV S RLMVQG G+ YNG IDAFR I Sbjct: 130 AAAGLSAAMAAQLVWTPVDVVSQRLMVQGSIGL--KKYNGGIDAFRQI 175 >ref|XP_022860851.1| solute carrier family 25 member 44-like, partial [Olea europaea var. sylvestris] Length = 372 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/54 (64%), Positives = 36/54 (66%), Gaps = 6/54 (11%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGG------NGV*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQGG + V YNG IDAFR I Sbjct: 156 AAAGLSAAMAAQLVWTPIDVVSQRLMVQGGGCDSTASAVGLQKYNGGIDAFRKI 209 >ref|XP_011081632.2| solute carrier family 25 member 44 [Sesamum indicum] Length = 334 Score = 59.7 bits (143), Expect = 9e-08 Identities = 35/54 (64%), Positives = 36/54 (66%), Gaps = 6/54 (11%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV------*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQGG V + YNG IDAFR I Sbjct: 117 AAAGLSAAMAAQLVWTPIDVVSQRLMVQGGGCVSGPCSNGSKKYNGGIDAFRKI 170 >gb|PIN24002.1| putative mitochondrial carrier protein [Handroanthus impetiginosus] Length = 354 Score = 59.7 bits (143), Expect = 9e-08 Identities = 35/54 (64%), Positives = 35/54 (64%), Gaps = 6/54 (11%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGG------NGV*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQGG V YNG IDAFR I Sbjct: 130 AAAGLSAAMAAQLVWTPIDVVSQRLMVQGGVCGTSSCAVDLKTYNGGIDAFRKI 183 >ref|XP_023736173.1| solute carrier family 25 member 44-like [Lactuca sativa] gb|PLY72013.1| hypothetical protein LSAT_8X99301 [Lactuca sativa] Length = 357 Score = 59.7 bits (143), Expect = 9e-08 Identities = 31/52 (59%), Positives = 37/52 (71%), Gaps = 5/52 (9%) Frame = -3 Query: 396 AAGLSAAMVVQSVWTPIDVAS*RLMVQGGNG-----V*TMVYNGDIDAFRSI 256 AAGLSAAMV Q VWTP+DV S RLM+QGG G + +++YNG DAF I Sbjct: 157 AAGLSAAMVAQLVWTPVDVVSQRLMIQGGKGANMRSLSSVMYNGGFDAFSKI 208 >ref|XP_001760564.1| predicted protein [Physcomitrella patens] gb|PNR62367.1| hypothetical protein PHYPA_000791 [Physcomitrella patens] Length = 328 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQGGNGV*TMVYNGDIDAFRSI 256 AAAGL+A+ Q VWTPIDV + RLMVQGG G + Y G IDAFR+I Sbjct: 130 AAAGLTASFAAQFVWTPIDVVTQRLMVQGGRGGLSTDYRGGIDAFRTI 177 >emb|CDP13443.1| unnamed protein product [Coffea canephora] Length = 342 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/56 (60%), Positives = 36/56 (64%), Gaps = 8/56 (14%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQG--------GNGV*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTP+DV S RLMVQG GN V Y+G IDAFR I Sbjct: 129 AAAGLSAAMAAQLVWTPVDVVSQRLMVQGSCCSNVRSGNAVALKSYSGGIDAFRKI 184 >gb|PHU01311.1| hypothetical protein BC332_31098 [Capsicum chinense] Length = 341 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/53 (67%), Positives = 36/53 (67%), Gaps = 5/53 (9%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQG-GNG----V*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQG GN V YNG IDAFR I Sbjct: 130 AAAGLSAAMAAQLVWTPIDVVSQRLMVQGSGNSSCGVVGLKCYNGGIDAFRKI 182 >gb|PHT32631.1| hypothetical protein CQW23_28968 [Capsicum baccatum] Length = 341 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/53 (67%), Positives = 36/53 (67%), Gaps = 5/53 (9%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQG-GNG----V*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQG GN V YNG IDAFR I Sbjct: 130 AAAGLSAAMAAQLVWTPIDVVSQRLMVQGSGNSSCGVVGLKCYNGGIDAFRKI 182 >ref|XP_016551577.1| PREDICTED: solute carrier family 25 member 44-like isoform X1 [Capsicum annuum] ref|XP_016551578.1| PREDICTED: solute carrier family 25 member 44-like isoform X2 [Capsicum annuum] gb|PHT66608.1| hypothetical protein T459_31033 [Capsicum annuum] Length = 341 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/53 (67%), Positives = 36/53 (67%), Gaps = 5/53 (9%) Frame = -3 Query: 399 AAAGLSAAMVVQSVWTPIDVAS*RLMVQG-GNG----V*TMVYNGDIDAFRSI 256 AAAGLSAAM Q VWTPIDV S RLMVQG GN V YNG IDAFR I Sbjct: 130 AAAGLSAAMAAQLVWTPIDVVSQRLMVQGSGNSSCGVVGLKCYNGGIDAFRKI 182