BLASTX nr result
ID: Chrysanthemum22_contig00004682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00004682 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022027778.1| uncharacterized protein LOC110928997 [Helian... 57 7e-07 >ref|XP_022027778.1| uncharacterized protein LOC110928997 [Helianthus annuus] gb|OTG30682.1| hypothetical protein HannXRQ_Chr03g0067191 [Helianthus annuus] Length = 233 Score = 56.6 bits (135), Expect = 7e-07 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = -2 Query: 401 NSFGSVGVSEGVNQWQQHCMIPQPPQNMSKPIAWSG 294 N GSV EG NQWQQHCMIPQ ++S P+AWSG Sbjct: 195 NGLGSVSGVEGANQWQQHCMIPQAAHSLSAPVAWSG 230