BLASTX nr result
ID: Chrysanthemum22_contig00004363
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00004363 (524 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW64075.1| hypothetical protein EUGRSUZ_G01736 [Eucalyptus g... 66 3e-10 >gb|KCW64075.1| hypothetical protein EUGRSUZ_G01736 [Eucalyptus grandis] Length = 164 Score = 65.9 bits (159), Expect = 3e-10 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -3 Query: 135 G*KVDNLVCSGLTSTRRKDDANNKSIKSKSFSENENEDHPDKQFW 1 G V +L+CSGL + R+DDA+NK+IK +SFSENE+EDHP+K+FW Sbjct: 102 GSAVPSLICSGLACSGRQDDAHNKTIKGQSFSENEDEDHPNKKFW 146