BLASTX nr result
ID: Chrysanthemum22_contig00004293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00004293 (362 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021988617.1| long chain acyl-CoA synthetase 6, peroxisoma... 59 1e-07 gb|KVH93576.1| AMP-binding, conserved site-containing protein [C... 57 6e-07 ref|XP_023742663.1| long chain acyl-CoA synthetase 6, peroxisoma... 55 3e-06 >ref|XP_021988617.1| long chain acyl-CoA synthetase 6, peroxisomal-like [Helianthus annuus] gb|OTG11238.1| putative long-chain acyl-CoA synthetase 6 [Helianthus annuus] Length = 697 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -3 Query: 360 FTMENGLLTPTFKVKRXXXXXXXXXAITDMYEEVSASVTSGRRIL 226 FTMENGLLTPTFKVKR AI DMYEEV+AS +SG+R+L Sbjct: 653 FTMENGLLTPTFKVKRPQAKAHFAKAIADMYEEVAASESSGKRVL 697 >gb|KVH93576.1| AMP-binding, conserved site-containing protein [Cynara cardunculus var. scolymus] Length = 639 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -3 Query: 360 FTMENGLLTPTFKVKRXXXXXXXXXAITDMYEEVSASVTSGRRIL 226 FTMENGLLTPTFKVKR AI DMYEEVS+S SG RI+ Sbjct: 595 FTMENGLLTPTFKVKRPQAKAYFAKAIADMYEEVSSSKLSGERIM 639 >ref|XP_023742663.1| long chain acyl-CoA synthetase 6, peroxisomal-like [Lactuca sativa] gb|PLY67051.1| hypothetical protein LSAT_5X149121 [Lactuca sativa] Length = 695 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -3 Query: 360 FTMENGLLTPTFKVKRXXXXXXXXXAITDMYEEVSASVTSGRRIL 226 FTMENGLLTPTFKVKR AI +MYEEVSAS +S R++L Sbjct: 651 FTMENGLLTPTFKVKRPQAKAYFAKAIENMYEEVSASESSSRKLL 695