BLASTX nr result
ID: Chrysanthemum22_contig00004007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00004007 (750 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH94434.1| Breast carcinoma amplified sequence 3, partial [C... 63 2e-07 ref|XP_023738445.1| autophagy-related protein 18g-like [Lactuca ... 61 7e-07 gb|PLY70183.1| hypothetical protein LSAT_9X1741 [Lactuca sativa] 61 7e-07 >gb|KVH94434.1| Breast carcinoma amplified sequence 3, partial [Cynara cardunculus var. scolymus] Length = 897 Score = 62.8 bits (151), Expect = 2e-07 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -2 Query: 206 SLDSGQSTEKTSDESVICLSKPASVSSTESSDGGLERLNLDLF 78 SL+SGQ EK SDESVICLSKPASVSSTESSDGG R +LF Sbjct: 711 SLESGQCREKASDESVICLSKPASVSSTESSDGGSSRRIENLF 753 >ref|XP_023738445.1| autophagy-related protein 18g-like [Lactuca sativa] Length = 893 Score = 60.8 bits (146), Expect = 7e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 206 SLDSGQSTEKTSDESVICLSKPASVSSTESSDGGLER 96 SL+SG+ EK SDESVICLSKPASVSSTESSDGG R Sbjct: 761 SLESGEDREKASDESVICLSKPASVSSTESSDGGSSR 797 >gb|PLY70183.1| hypothetical protein LSAT_9X1741 [Lactuca sativa] Length = 894 Score = 60.8 bits (146), Expect = 7e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 206 SLDSGQSTEKTSDESVICLSKPASVSSTESSDGGLER 96 SL+SG+ EK SDESVICLSKPASVSSTESSDGG R Sbjct: 761 SLESGEDREKASDESVICLSKPASVSSTESSDGGSSR 797