BLASTX nr result
ID: Chrysanthemum22_contig00003993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00003993 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI47364.1| hypothetical protein CRG98_032199 [Punica granatum] 53 3e-06 gb|KCW85909.1| hypothetical protein EUGRSUZ_B02623 [Eucalyptus g... 54 8e-06 ref|XP_010043890.1| PREDICTED: uncharacterized protein At2g02148... 54 8e-06 >gb|PKI47364.1| hypothetical protein CRG98_032199 [Punica granatum] Length = 105 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/42 (64%), Positives = 29/42 (69%) Frame = -2 Query: 126 PWFIRNPVTANCSDIRLRFPELVIQEEKRVRFVVFNGLDIIE 1 P R A + R RFPELVIQEEKRVRFVV NGLDI+E Sbjct: 52 PCTYRRRELATSVETRTRFPELVIQEEKRVRFVVINGLDIVE 93 >gb|KCW85909.1| hypothetical protein EUGRSUZ_B02623 [Eucalyptus grandis] Length = 339 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -2 Query: 126 PWFIRNPVTANCSDIRLRFPELVIQEEKRVRFVVFNGLDIIE 1 P+ R A ++ R +FPELVIQEEKRVRFVV NGLDI+E Sbjct: 212 PYTFRRRELATSAETRTKFPELVIQEEKRVRFVVVNGLDIVE 253 >ref|XP_010043890.1| PREDICTED: uncharacterized protein At2g02148 [Eucalyptus grandis] gb|KCW85908.1| hypothetical protein EUGRSUZ_B02623 [Eucalyptus grandis] Length = 448 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -2 Query: 126 PWFIRNPVTANCSDIRLRFPELVIQEEKRVRFVVFNGLDIIE 1 P+ R A ++ R +FPELVIQEEKRVRFVV NGLDI+E Sbjct: 212 PYTFRRRELATSAETRTKFPELVIQEEKRVRFVVVNGLDIVE 253