BLASTX nr result
ID: Chrysanthemum22_contig00003930
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00003930 (746 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY67928.1| hypothetical protein LSAT_5X159741 [Lactuca sativa] 57 2e-07 >gb|PLY67928.1| hypothetical protein LSAT_5X159741 [Lactuca sativa] Length = 67 Score = 57.0 bits (136), Expect = 2e-07 Identities = 30/63 (47%), Positives = 39/63 (61%) Frame = -3 Query: 537 MAGLQYNFFPTDFLCPQSKQNNTKATAAQDLVMNSKTSKVSLDDLTKLKCSVSTKNHIKT 358 MAGLQYNFFPTDFL PQS + + Q L + + ++ L+D TK+K + K IKT Sbjct: 1 MAGLQYNFFPTDFLYPQSTKISKDVLLPQTLPLIIQKPEILLEDSTKMKSANGIKKQIKT 60 Query: 357 LKL 349 KL Sbjct: 61 PKL 63