BLASTX nr result
ID: Chrysanthemum22_contig00003850
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00003850 (551 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023746934.1| TMV resistance protein N-like isoform X2 [La... 61 1e-07 ref|XP_023761328.1| disease resistance protein RML1B-like [Lactu... 60 2e-07 gb|PLY87371.1| hypothetical protein LSAT_1X79100 [Lactuca sativa] 60 3e-07 ref|XP_023746948.1| disease resistance protein RLM3-like [Lactuc... 60 3e-07 gb|PLY63863.1| hypothetical protein LSAT_1X93600 [Lactuca sativa] 60 3e-07 ref|XP_023746929.1| disease resistance protein RML1A-like isofor... 60 5e-07 ref|XP_023746928.1| disease resistance protein RML1A-like isofor... 60 5e-07 gb|PLY65021.1| hypothetical protein LSAT_1X91860 [Lactuca sativa] 60 5e-07 ref|XP_023746954.1| disease resistance protein RLM3-like [Lactuc... 59 6e-07 ref|XP_023733251.1| disease resistance protein RML1A-like [Lactu... 59 6e-07 ref|XP_023745408.1| disease resistance protein RML1A-like isofor... 59 6e-07 ref|XP_023745407.1| disease resistance protein RML1A-like isofor... 59 6e-07 ref|XP_023745402.1| disease resistance protein RML1A-like isofor... 59 6e-07 gb|PLY65061.1| hypothetical protein LSAT_1X91940 [Lactuca sativa] 58 2e-06 ref|XP_023745409.1| TMV resistance protein N-like [Lactuca sativ... 58 2e-06 ref|XP_023746969.1| disease resistance protein RML1A-like [Lactu... 57 3e-06 gb|PLY63873.1| hypothetical protein LSAT_1X93941 [Lactuca sativa] 57 4e-06 ref|XP_023767405.1| disease resistance-like protein DSC1 isoform... 57 5e-06 ref|XP_023767397.1| disease resistance-like protein DSC1 isoform... 57 5e-06 gb|PLY98138.1| hypothetical protein LSAT_1X101960 [Lactuca sativa] 57 5e-06 >ref|XP_023746934.1| TMV resistance protein N-like isoform X2 [Lactuca sativa] Length = 495 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET+FIEEIV +I+ +L V LRS PQLIG+NY ++F++SWL+DGS H Sbjct: 199 RLETEFIEEIVKDIHCRLHVHLRSV---GPQLIGMNYHINFVTSWLKDGSSH 247 >ref|XP_023761328.1| disease resistance protein RML1B-like [Lactuca sativa] Length = 1166 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET+FIEEIV +IY +L V LRS L P LIG++YS+ F++SWL+D S H Sbjct: 197 RLETEFIEEIVNDIYGRLRVHLRSDL---PLLIGMDYSIKFVTSWLKDASTH 245 >gb|PLY87371.1| hypothetical protein LSAT_1X79100 [Lactuca sativa] Length = 1230 Score = 60.5 bits (145), Expect = 3e-07 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET+FIEEIV +IY +L V LRS L P LIG++YS+ F++SWL+D S H Sbjct: 178 RLETEFIEEIVNDIYGRLRVHLRSDL---PLLIGMDYSIKFVTSWLKDASTH 226 >ref|XP_023746948.1| disease resistance protein RLM3-like [Lactuca sativa] Length = 392 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET FIEEIV +I+ +L V LRS P QLIG+NY ++F++SWL+DGS H Sbjct: 232 RLETVFIEEIVKDIHRRLHVHLRSVRP---QLIGMNYHINFVTSWLKDGSSH 280 >gb|PLY63863.1| hypothetical protein LSAT_1X93600 [Lactuca sativa] Length = 756 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET FIEEIV +I+ +L V LRS P QLIG+NY ++F++SWL+DGS H Sbjct: 199 RLETVFIEEIVKDIHRRLHVHLRSVRP---QLIGMNYHINFVTSWLKDGSSH 247 >ref|XP_023746929.1| disease resistance protein RML1A-like isoform X2 [Lactuca sativa] Length = 1221 Score = 59.7 bits (143), Expect = 5e-07 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET+FIEEIV +I+H+L V LRS PQLIG+ ++F++SWL+DGS H Sbjct: 196 RLETEFIEEIVKDIHHRLYVPLRSV---KPQLIGMKDDINFITSWLKDGSSH 244 >ref|XP_023746928.1| disease resistance protein RML1A-like isoform X1 [Lactuca sativa] gb|PLY63867.1| hypothetical protein LSAT_1X94481 [Lactuca sativa] Length = 1222 Score = 59.7 bits (143), Expect = 5e-07 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET+FIEEIV +I+H+L V LRS PQLIG+ ++F++SWL+DGS H Sbjct: 196 RLETEFIEEIVKDIHHRLYVPLRSV---KPQLIGMKDDINFITSWLKDGSSH 244 >gb|PLY65021.1| hypothetical protein LSAT_1X91860 [Lactuca sativa] Length = 2085 Score = 59.7 bits (143), Expect = 5e-07 Identities = 28/54 (51%), Positives = 41/54 (75%) Frame = -1 Query: 164 LTRLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 + R ET+FIEEIV +IY +L V L+S+ P IG++YS++F++SWL+DGS H Sbjct: 1244 ILRFETEFIEEIVKDIYRRLHVPLKSA---QPLFIGMDYSINFITSWLKDGSSH 1294 Score = 59.3 bits (142), Expect = 7e-07 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R ET+FIEEIV +IY +L V L+S+ P IG++YS++F++SWL+DGS H Sbjct: 185 RFETEFIEEIVKDIYRRLHVPLKSA---QPLFIGMDYSINFITSWLKDGSSH 233 >ref|XP_023746954.1| disease resistance protein RLM3-like [Lactuca sativa] Length = 351 Score = 58.9 bits (141), Expect = 6e-07 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET FIEEIV +I+ +L + LRS P QLIG+NY ++F++SWL+DGS H Sbjct: 199 RLETVFIEEIVKDIHRRLHLHLRSIRP---QLIGMNYHINFVTSWLKDGSSH 247 >ref|XP_023733251.1| disease resistance protein RML1A-like [Lactuca sativa] ref|XP_023733252.1| disease resistance protein RML1A-like [Lactuca sativa] gb|PLY74245.1| hypothetical protein LSAT_1X66260 [Lactuca sativa] Length = 1201 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET+FIEEIV +IY +L + LRS P QLIG+ +S++F++SWL+D S H Sbjct: 185 RLETEFIEEIVKDIYRRLHIPLRSVRP---QLIGMEFSIEFITSWLKDTSSH 233 >ref|XP_023745408.1| disease resistance protein RML1A-like isoform X3 [Lactuca sativa] Length = 1214 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R ET+FIEEIV +IY +L V L+S+ P IG++YS++F++SWL+DGS H Sbjct: 185 RFETEFIEEIVKDIYRRLHVPLKSA---QPLFIGMDYSINFITSWLKDGSSH 233 >ref|XP_023745407.1| disease resistance protein RML1A-like isoform X2 [Lactuca sativa] Length = 1220 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R ET+FIEEIV +IY +L V L+S+ P IG++YS++F++SWL+DGS H Sbjct: 185 RFETEFIEEIVKDIYRRLHVPLKSA---QPLFIGMDYSINFITSWLKDGSSH 233 >ref|XP_023745402.1| disease resistance protein RML1A-like isoform X1 [Lactuca sativa] ref|XP_023745403.1| disease resistance protein RML1A-like isoform X1 [Lactuca sativa] ref|XP_023745404.1| disease resistance protein RML1A-like isoform X1 [Lactuca sativa] ref|XP_023745405.1| disease resistance protein RML1A-like isoform X1 [Lactuca sativa] ref|XP_023745406.1| disease resistance protein RML1A-like isoform X1 [Lactuca sativa] Length = 1225 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R ET+FIEEIV +IY +L V L+S+ P IG++YS++F++SWL+DGS H Sbjct: 185 RFETEFIEEIVKDIYRRLHVPLKSA---QPLFIGMDYSINFITSWLKDGSSH 233 >gb|PLY65061.1| hypothetical protein LSAT_1X91940 [Lactuca sativa] Length = 979 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R ET+FIEEIV ++Y +L V L+S P IG++YS++F++SWL+DGS H Sbjct: 192 RFETEFIEEIVKDVYRRLHVPLKSV---QPLFIGMDYSINFITSWLKDGSSH 240 >ref|XP_023745409.1| TMV resistance protein N-like [Lactuca sativa] ref|XP_023745411.1| TMV resistance protein N-like [Lactuca sativa] Length = 1023 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R ET+FIEEIV ++Y +L V L+S P IG++YS++F++SWL+DGS H Sbjct: 192 RFETEFIEEIVKDVYRRLHVPLKSV---QPLFIGMDYSINFITSWLKDGSSH 240 >ref|XP_023746969.1| disease resistance protein RML1A-like [Lactuca sativa] Length = 1187 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 RLET+FIEEIV +I+ +L V LRS+ P IG++Y ++F++SWL+DGS H Sbjct: 186 RLETEFIEEIVKDIHRRLHVPLRST---QPLFIGMDYHINFVTSWLKDGSTH 234 >gb|PLY63873.1| hypothetical protein LSAT_1X93941 [Lactuca sativa] Length = 1097 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R ET+FI EIV +IY +L V LRS+ P LIG++Y +DF++SWL++GS H Sbjct: 192 RFETEFIGEIVKDIYRRLKVPLRSA---QPLLIGMDYHIDFVTSWLKNGSSH 240 >ref|XP_023767405.1| disease resistance-like protein DSC1 isoform X2 [Lactuca sativa] Length = 1036 Score = 56.6 bits (135), Expect = 5e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R E +FIEEIVT+IY +L + RS LP QL G++YS+ F++SWL+D S H Sbjct: 6 RQEMEFIEEIVTDIYRRLHISSRSHLP---QLFGMDYSIKFVTSWLKDTSSH 54 >ref|XP_023767397.1| disease resistance-like protein DSC1 isoform X1 [Lactuca sativa] Length = 1038 Score = 56.6 bits (135), Expect = 5e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R E +FIEEIVT+IY +L + RS LP QL G++YS+ F++SWL+D S H Sbjct: 8 RQEMEFIEEIVTDIYRRLHISSRSHLP---QLFGMDYSIKFVTSWLKDTSSH 56 >gb|PLY98138.1| hypothetical protein LSAT_1X101960 [Lactuca sativa] Length = 1151 Score = 56.6 bits (135), Expect = 5e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -1 Query: 158 RLETDFIEEIVTNIYHQLGVLLRSSLPRDPQLIGINYSVDFLSSWLQDGSEH 3 R E +FIEEIVT+IY +L + RS LP QL G++YS+ F++SWL+D S H Sbjct: 119 RQEMEFIEEIVTDIYRRLHISSRSHLP---QLFGMDYSIKFVTSWLKDTSSH 167