BLASTX nr result
ID: Chrysanthemum22_contig00003801
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00003801 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_076489808.1| hypothetical protein [Alkalispirochaeta amer... 52 2e-06 >ref|WP_076489808.1| hypothetical protein [Alkalispirochaeta americana] Length = 70 Score = 52.4 bits (124), Expect = 2e-06 Identities = 22/62 (35%), Positives = 27/62 (43%) Frame = +1 Query: 4 WLQWVW*LRRWKSRVWGSNWCAVWKPKCTKCRLWKRSICCCPKLVEFSAFFWIWWCWSLW 183 WL W W RRW +W WC W+ C W+R C C + + W WCW W Sbjct: 6 WLWWCWCWRRW---LW---WCWCWRRWLWWCWCWRRWPCWCWLCWLWLCWLWWCWCWRRW 59 Query: 184 KC 189 C Sbjct: 60 PC 61