BLASTX nr result
ID: Chrysanthemum22_contig00003723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00003723 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021976284.1| photosynthetic NDH subunit of lumenal locati... 79 8e-15 ref|XP_002272064.1| PREDICTED: photosynthetic NDH subunit of lum... 77 2e-14 ref|XP_022877746.1| photosynthetic NDH subunit of lumenal locati... 77 3e-14 ref|XP_021912022.1| photosynthetic NDH subunit of lumenal locati... 77 4e-14 ref|XP_023754647.1| casparian strip membrane protein 1 [Lactuca ... 77 5e-14 sp|P0DI35.1|CASP1_LACSI RecName: Full=Casparian strip membrane p... 77 5e-14 gb|PIM98251.1| hypothetical protein CDL12_29269 [Handroanthus im... 76 5e-14 ref|XP_010258294.1| PREDICTED: photosynthetic NDH subunit of lum... 76 6e-14 ref|XP_011070986.1| photosynthetic NDH subunit of lumenal locati... 76 6e-14 ref|XP_015895040.1| PREDICTED: photosynthetic NDH subunit of lum... 76 7e-14 ref|XP_016703888.1| PREDICTED: photosynthetic NDH subunit of lum... 76 1e-13 ref|XP_012465506.1| PREDICTED: photosynthetic NDH subunit of lum... 76 1e-13 ref|XP_007046041.1| PREDICTED: photosynthetic NDH subunit of lum... 76 1e-13 gb|OWM75928.1| hypothetical protein CDL15_Pgr009572 [Punica gran... 75 1e-13 ref|XP_021807428.1| photosynthetic NDH subunit of lumenal locati... 75 1e-13 ref|XP_008221594.1| PREDICTED: photosynthetic NDH subunit of lum... 75 1e-13 ref|XP_007225851.1| photosynthetic NDH subunit of lumenal locati... 75 1e-13 ref|XP_008437911.1| PREDICTED: photosynthetic NDH subunit of lum... 75 2e-13 ref|XP_004133817.1| PREDICTED: photosynthetic NDH subunit of lum... 75 2e-13 gb|OVA12246.1| Photosystem II PsbQ [Macleaya cordata] 76 2e-13 >ref|XP_021976284.1| photosynthetic NDH subunit of lumenal location 2, chloroplastic [Helianthus annuus] gb|OTG17327.1| putative psbQ-like protein [Helianthus annuus] Length = 207 Score = 79.0 bits (193), Expect = 8e-15 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNMSEFDYYVRTPKVYESYLYYEKTL+S+DDLVAVLA Sbjct: 169 LVDNMSEFDYYVRTPKVYESYLYYEKTLKSLDDLVAVLA 207 >ref|XP_002272064.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Vitis vinifera] emb|CBI31938.3| unnamed protein product, partial [Vitis vinifera] Length = 188 Score = 77.4 bits (189), Expect = 2e-14 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+EFDYYVRTPKVYESYLYYEKTL+SIDDLVA+LA Sbjct: 150 LVDNMAEFDYYVRTPKVYESYLYYEKTLKSIDDLVAMLA 188 >ref|XP_022877746.1| photosynthetic NDH subunit of lumenal location 2, chloroplastic [Olea europaea var. sylvestris] Length = 194 Score = 77.0 bits (188), Expect = 3e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+EFDYY+RTPKVYESYLYYEKTL+SIDDLVA+LA Sbjct: 156 LVDNMAEFDYYIRTPKVYESYLYYEKTLKSIDDLVALLA 194 >ref|XP_021912022.1| photosynthetic NDH subunit of lumenal location 2, chloroplastic [Carica papaya] Length = 186 Score = 76.6 bits (187), Expect = 4e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+EFDYYVRTPKVYESY+YYEKTL+SIDDLVA+LA Sbjct: 148 LVDNMAEFDYYVRTPKVYESYIYYEKTLKSIDDLVALLA 186 >ref|XP_023754647.1| casparian strip membrane protein 1 [Lactuca sativa] gb|PLY99116.1| hypothetical protein LSAT_8X50921 [Lactuca sativa] Length = 192 Score = 76.6 bits (187), Expect = 5e-14 Identities = 36/57 (63%), Positives = 38/57 (66%) Frame = +2 Query: 62 HNGNSSTNWLPVCQQYGDFCQGASGSLIGSFXXXXXXXXXXXXXXXXXSRHPKRIHL 232 HNGN+STNWLPVCQQYGDFCQGASGSLIGSF SRH KR+ L Sbjct: 136 HNGNTSTNWLPVCQQYGDFCQGASGSLIGSFGAVVVFILIILLGAIALSRHAKRVVL 192 >sp|P0DI35.1|CASP1_LACSI RecName: Full=Casparian strip membrane protein 1; Short=LsCASP1 Length = 192 Score = 76.6 bits (187), Expect = 5e-14 Identities = 36/57 (63%), Positives = 38/57 (66%) Frame = +2 Query: 62 HNGNSSTNWLPVCQQYGDFCQGASGSLIGSFXXXXXXXXXXXXXXXXXSRHPKRIHL 232 HNGN+STNWLPVCQQYGDFCQGASGSLIGSF SRH KR+ L Sbjct: 136 HNGNTSTNWLPVCQQYGDFCQGASGSLIGSFGAVVVFILIILLGAIALSRHAKRVVL 192 >gb|PIM98251.1| hypothetical protein CDL12_29269 [Handroanthus impetiginosus] Length = 183 Score = 76.3 bits (186), Expect = 5e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+EFDYYVRTPKVYESY+YYEKTL+SIDDLVA+LA Sbjct: 145 LVDNMAEFDYYVRTPKVYESYVYYEKTLKSIDDLVALLA 183 >ref|XP_010258294.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Nelumbo nucifera] Length = 191 Score = 76.3 bits (186), Expect = 6e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+EFDYYVRTPKVYESYLYYEKTL+S+DDLVA+LA Sbjct: 153 LVDNMAEFDYYVRTPKVYESYLYYEKTLKSMDDLVAMLA 191 >ref|XP_011070986.1| photosynthetic NDH subunit of lumenal location 2, chloroplastic [Sesamum indicum] Length = 193 Score = 76.3 bits (186), Expect = 6e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+EFDYYVRTPKVYESY+YYEKTL+SIDDLVA+LA Sbjct: 155 LVDNMAEFDYYVRTPKVYESYVYYEKTLKSIDDLVALLA 193 >ref|XP_015895040.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Ziziphus jujuba] Length = 194 Score = 76.3 bits (186), Expect = 7e-14 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+EFDYYVRTPKVYESY+YYEKTL+SIDDLVA+LA Sbjct: 156 LVDNMAEFDYYVRTPKVYESYVYYEKTLKSIDDLVALLA 194 >ref|XP_016703888.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic-like [Gossypium hirsutum] gb|PPD97610.1| hypothetical protein GOBAR_DD05368 [Gossypium barbadense] Length = 198 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVL 429 LVDNM+EFDYYVRTPKVYESYLYYEKTL+SIDDLVA+L Sbjct: 160 LVDNMAEFDYYVRTPKVYESYLYYEKTLKSIDDLVALL 197 >ref|XP_012465506.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Gossypium raimondii] gb|KJB80227.1| hypothetical protein B456_013G087300 [Gossypium raimondii] Length = 198 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVL 429 LVDNM+EFDYYVRTPKVYESYLYYEKTL+SIDDLVA+L Sbjct: 160 LVDNMAEFDYYVRTPKVYESYLYYEKTLKSIDDLVALL 197 >ref|XP_007046041.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Theobroma cacao] gb|EOY01873.1| PsbQ-like 2 [Theobroma cacao] Length = 201 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVL 429 LVDNM+EFDYYVRTPKVYESYLYYEKTL+SIDDLVA+L Sbjct: 163 LVDNMAEFDYYVRTPKVYESYLYYEKTLKSIDDLVALL 200 >gb|OWM75928.1| hypothetical protein CDL15_Pgr009572 [Punica granatum] gb|PKI36806.1| hypothetical protein CRG98_042755 [Punica granatum] Length = 187 Score = 75.5 bits (184), Expect = 1e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNMSE DYYVRTPKVYESY+YYEKTL+SIDDLVA+LA Sbjct: 149 LVDNMSELDYYVRTPKVYESYMYYEKTLKSIDDLVAMLA 187 >ref|XP_021807428.1| photosynthetic NDH subunit of lumenal location 2, chloroplastic [Prunus avium] Length = 200 Score = 75.5 bits (184), Expect = 1e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LV+NM+EFDYYVRTPKVYESYLYYEKTL+SIDDLVA+LA Sbjct: 162 LVNNMTEFDYYVRTPKVYESYLYYEKTLKSIDDLVALLA 200 >ref|XP_008221594.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Prunus mume] Length = 200 Score = 75.5 bits (184), Expect = 1e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LV+NM+EFDYYVRTPKVYESYLYYEKTL+SIDDLVA+LA Sbjct: 162 LVNNMTEFDYYVRTPKVYESYLYYEKTLKSIDDLVAMLA 200 >ref|XP_007225851.1| photosynthetic NDH subunit of lumenal location 2, chloroplastic [Prunus persica] gb|ONI30854.1| hypothetical protein PRUPE_1G277200 [Prunus persica] Length = 200 Score = 75.5 bits (184), Expect = 1e-13 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LV+NM+EFDYYVRTPKVYESYLYYEKTL+SIDDLVA+LA Sbjct: 162 LVNNMTEFDYYVRTPKVYESYLYYEKTLKSIDDLVALLA 200 >ref|XP_008437911.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Cucumis melo] Length = 186 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+E DYYVRTPKVYESYLYYEKTL+SIDDLVA+LA Sbjct: 148 LVDNMAELDYYVRTPKVYESYLYYEKTLKSIDDLVALLA 186 >ref|XP_004133817.1| PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Cucumis sativus] gb|KGN56433.1| hypothetical protein Csa_3G119660 [Cucumis sativus] Length = 187 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+E DYYVRTPKVYESYLYYEKTL+SIDDLVA+LA Sbjct: 149 LVDNMAELDYYVRTPKVYESYLYYEKTLKSIDDLVALLA 187 >gb|OVA12246.1| Photosystem II PsbQ [Macleaya cordata] Length = 227 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -3 Query: 542 LVDNMSEFDYYVRTPKVYESYLYYEKTLQSIDDLVAVLA 426 LVDNM+EFDYYVRTPKVYESY+YYEKTL+S+DDLVA+LA Sbjct: 189 LVDNMAEFDYYVRTPKVYESYIYYEKTLKSLDDLVALLA 227