BLASTX nr result
ID: Chrysanthemum22_contig00003468
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00003468 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO47650.1| hypothetical protein SQ11_16140, partial [Nitroso... 58 2e-08 gb|AAN32999.1| alpha-tubulin 3, partial [Gossypium hirsutum] 58 3e-08 gb|ADF32934.1| alpha-tubulin, partial [Nothoholosticha fasciola]... 60 4e-08 gb|AGH32900.1| alpha-tubulin, partial [Camellia oleifera] 57 5e-08 emb|SIP56163.1| alpha-tubulin isoform 6, partial [Sticholonche z... 58 5e-08 ref|XP_016578855.1| PREDICTED: tubulin alpha-1 chain-like [Capsi... 57 6e-08 gb|PNX69998.1| tubulin alpha-3 chain-like protein, partial [Trif... 57 7e-08 emb|CBI29424.3| unnamed protein product, partial [Vitis vinifera] 59 7e-08 emb|CDY46272.1| BnaC05g50610D [Brassica napus] 59 8e-08 gb|AAN32998.1| alpha-tubulin 2, partial [Gossypium hirsutum] 58 8e-08 gb|ACJ37364.1| alpha tubulin, partial [Garcinia mangostana] 58 8e-08 gb|ABL61204.1| alpha-tubulin, partial [Oxymonadida environmental... 59 8e-08 gb|ABB82561.1| alpha-tubulin, partial [Primula vulgaris] 58 8e-08 ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica r... 59 1e-07 gb|AKH44449.1| alpha-tubulin I, partial [Plasmodium floridense] ... 58 1e-07 gb|AAP93564.1| alpha-tubulin, partial [Chilodonella uncinata] 58 1e-07 gb|AAP93569.1| alpha-tubulin, partial [Chilodonella uncinata] >g... 58 1e-07 gb|AEW08142.1| hypothetical protein 2_945_01, partial [Pinus tae... 57 1e-07 ref|XP_001763547.1| predicted protein [Physcomitrella patens] 59 1e-07 gb|AFR42036.1| alpha-tubulin, partial [Populus alba] 58 1e-07 >gb|KIO47650.1| hypothetical protein SQ11_16140, partial [Nitrosospira sp. NpAV] Length = 89 Score = 57.8 bits (138), Expect = 2e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 1 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVIS 36 >gb|AAN32999.1| alpha-tubulin 3, partial [Gossypium hirsutum] Length = 114 Score = 57.8 bits (138), Expect = 3e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 38 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVIS 73 >gb|ADF32934.1| alpha-tubulin, partial [Nothoholosticha fasciola] gb|AJP08928.1| alpha-tubulin, partial [Nothoholosticha fasciola] Length = 357 Score = 60.5 bits (145), Expect = 4e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+GVT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 196 LRFDGALNVGVTEFQTNLVPYPRIHFMLSSYAPVIS 231 >gb|AGH32900.1| alpha-tubulin, partial [Camellia oleifera] Length = 103 Score = 57.0 bits (136), Expect = 5e-08 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGA+N+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 27 LRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVIS 62 >emb|SIP56163.1| alpha-tubulin isoform 6, partial [Sticholonche zanclea] Length = 141 Score = 57.8 bits (138), Expect = 5e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 95 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVIS 130 >ref|XP_016578855.1| PREDICTED: tubulin alpha-1 chain-like [Capsicum annuum] Length = 131 Score = 57.4 bits (137), Expect = 6e-08 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ V KFQT+ PYPRIHFM SSYAP ++ Sbjct: 13 LRFDGALNVDVNKFQTNLVPYPRIHFMLSSYAPVIS 48 >gb|PNX69998.1| tubulin alpha-3 chain-like protein, partial [Trifolium pratense] Length = 107 Score = 56.6 bits (135), Expect = 7e-08 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGA+N+ +T+FQT+ PYPRIHFM SSYAP ++ Sbjct: 3 LRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVIS 38 >emb|CBI29424.3| unnamed protein product, partial [Vitis vinifera] Length = 287 Score = 59.3 bits (142), Expect = 7e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA*FTCSLQSR 334 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP +A C L R Sbjct: 242 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPYMA---CCLMYR 283 >emb|CDY46272.1| BnaC05g50610D [Brassica napus] Length = 289 Score = 59.3 bits (142), Expect = 8e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP L+ Sbjct: 91 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPQLS 126 >gb|AAN32998.1| alpha-tubulin 2, partial [Gossypium hirsutum] Length = 163 Score = 57.8 bits (138), Expect = 8e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 94 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVIS 129 >gb|ACJ37364.1| alpha tubulin, partial [Garcinia mangostana] Length = 164 Score = 57.8 bits (138), Expect = 8e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 85 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVIS 120 >gb|ABL61204.1| alpha-tubulin, partial [Oxymonadida environmental sample] Length = 299 Score = 59.3 bits (142), Expect = 8e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ +T+FQTD PYPRIHFM SSYAP ++ Sbjct: 90 LRFDGALNVDITEFQTDLVPYPRIHFMLSSYAPVIS 125 >gb|ABB82561.1| alpha-tubulin, partial [Primula vulgaris] Length = 166 Score = 57.8 bits (138), Expect = 8e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 98 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVIS 133 >ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa] Length = 450 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ APYPRIHFM SSYAP ++ Sbjct: 242 LRFDGALNVDVTEFQTNLAPYPRIHFMLSSYAPVIS 277 >gb|AKH44449.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44450.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44451.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44452.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44453.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44454.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44455.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44456.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44457.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44458.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44459.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44460.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44461.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44462.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44463.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44464.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44465.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44466.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44467.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44468.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44469.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44470.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44471.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44472.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44473.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44474.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44475.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44476.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44477.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44478.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44479.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44480.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44481.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44482.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44483.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44484.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44485.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44486.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44488.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44489.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44490.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44491.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44492.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44493.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44494.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44495.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44496.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44497.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44498.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44499.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44500.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44501.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44502.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44503.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44504.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44505.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44506.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44507.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44508.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44509.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44510.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44511.1| alpha-tubulin I, partial [Plasmodium floridense] gb|AKH44512.1| alpha-tubulin I, partial [Plasmodium floridense] Length = 180 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 85 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIIS 120 >gb|AAP93564.1| alpha-tubulin, partial [Chilodonella uncinata] Length = 182 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 21 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIIS 56 >gb|AAP93569.1| alpha-tubulin, partial [Chilodonella uncinata] gb|AAP93570.1| alpha-tubulin, partial [Chilodonella uncinata] Length = 182 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 21 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIIS 56 >gb|AEW08142.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AEW08143.1| hypothetical protein 2_945_01, partial [Pinus radiata] gb|AFG70651.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70652.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70653.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70654.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70655.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70656.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70657.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70658.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70659.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70660.1| hypothetical protein 2_945_01, partial [Pinus taeda] gb|AFG70661.1| hypothetical protein 2_945_01, partial [Pinus taeda] Length = 145 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGA+N+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 27 LRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVIS 62 >ref|XP_001763547.1| predicted protein [Physcomitrella patens] Length = 350 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L FDGALNM +TKFQT+ PYPRIHFM SSYAP ++ Sbjct: 175 LWFDGALNMDLTKFQTNLVPYPRIHFMLSSYAPMIS 210 >gb|AFR42036.1| alpha-tubulin, partial [Populus alba] Length = 195 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 200 LQFDGALNMGVTKFQTDRAPYPRIHFMFSSYAPSLA 307 L+FDGALN+ VT+FQT+ PYPRIHFM SSYAP ++ Sbjct: 1 LRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVIS 36