BLASTX nr result
ID: Chrysanthemum22_contig00003328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00003328 (842 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH94658.1| hypothetical protein Ccrd_003286 [Cynara carduncu... 103 6e-21 >gb|KVH94658.1| hypothetical protein Ccrd_003286 [Cynara cardunculus var. scolymus] Length = 865 Score = 103 bits (256), Expect = 6e-21 Identities = 58/108 (53%), Positives = 72/108 (66%), Gaps = 13/108 (12%) Frame = +3 Query: 303 ENKKSVNDQYDKSKYSPEKLTSHLPSGTQAQKRTSKNDEGWRNYSELADEPLRSRKNVLT 482 +NK +VND+ DK+K+SPE SH S QAQKR SK+D+G RNY ELA+EPL SRK+ L+ Sbjct: 564 QNKNTVNDRRDKNKHSPE-FASHHSSDAQAQKRKSKSDDGRRNYPELAEEPLGSRKDNLS 622 Query: 483 SERERVPEKGYKVNEIN-------------QEAVKLPKSLPKVERQTQ 587 S+R R+ EKGYK +E N QEA KLPK L KVER + Sbjct: 623 SDRARISEKGYKTDEKNQLRASDVKGSPRHQEAAKLPKLLQKVERHNR 670