BLASTX nr result
ID: Chrysanthemum22_contig00003162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00003162 (891 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI04058.1| hypothetical protein Ccrd_017637 [Cynara carduncu... 59 7e-06 >gb|KVI04058.1| hypothetical protein Ccrd_017637 [Cynara cardunculus var. scolymus] Length = 593 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 EPERESRCAKAILRWSFWLLSQAQGLRSWV 92 EP+RESRCA+AILRWSFWLLSQAQGLR+ V Sbjct: 199 EPDRESRCARAILRWSFWLLSQAQGLRNAV 228