BLASTX nr result
ID: Chrysanthemum22_contig00002979
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00002979 (563 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG00199.1| putative alpha/gamma-adaptin-binding protein p34 ... 56 2e-06 ref|XP_021999865.1| uncharacterized protein LOC110897414 [Helian... 56 6e-06 >gb|OTG00199.1| putative alpha/gamma-adaptin-binding protein p34 [Helianthus annuus] Length = 203 Score = 56.2 bits (134), Expect = 2e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -1 Query: 152 SDEEKPNYELEYEIFSAGLVEPWDDMDVS*VFATNESDD 36 S +E+PNYE +YE+ SAG VEPWDD DVS V ATN++ + Sbjct: 68 SSDEEPNYEFKYEVLSAGSVEPWDDTDVSWVSATNDNTE 106 >ref|XP_021999865.1| uncharacterized protein LOC110897414 [Helianthus annuus] Length = 383 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -1 Query: 152 SDEEKPNYELEYEIFSAGLVEPWDDMDVS*VFATNESDD 36 S +E+PNYE +YE+ SAG VEPWDD DVS V ATN++ + Sbjct: 248 SSDEEPNYEFKYEVLSAGSVEPWDDTDVSWVSATNDNTE 286