BLASTX nr result
ID: Chrysanthemum22_contig00002847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00002847 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI09325.1| hypothetical protein Ccrd_012293 [Cynara carduncu... 58 8e-07 >gb|KVI09325.1| hypothetical protein Ccrd_012293 [Cynara cardunculus var. scolymus] Length = 338 Score = 57.8 bits (138), Expect = 8e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 91 YFIGDDENTNDMPPSSSCDSPTRQLNYDEE 2 Y +GDDENTND+PP+SSC SPTRQLNY EE Sbjct: 107 YSLGDDENTNDLPPTSSCGSPTRQLNYGEE 136