BLASTX nr result
ID: Chrysanthemum22_contig00002839
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00002839 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023729765.1| zinc finger A20 and AN1 domain-containing st... 109 2e-27 gb|KVH90830.1| Zinc finger, AN1-type [Cynara cardunculus var. sc... 107 7e-27 gb|PLY76967.1| hypothetical protein LSAT_6X48240 [Lactuca sativa] 109 1e-26 gb|KVI09450.1| Zinc finger, AN1-type [Cynara cardunculus var. sc... 106 2e-26 gb|AMB19672.1| putative A20/AN1-like zinc finger family protein ... 104 2e-25 ref|XP_023733256.1| zinc finger A20 and AN1 domain-containing st... 102 9e-25 ref|XP_023751481.1| zinc finger A20 and AN1 domain-containing st... 102 9e-25 ref|XP_022896572.1| zinc finger A20 and AN1 domain-containing st... 101 2e-24 gb|KVI00229.1| Zinc finger, AN1-type [Cynara cardunculus var. sc... 101 3e-24 ref|XP_022865224.1| zinc finger A20 and AN1 domain-containing st... 100 5e-24 ref|XP_022001154.1| zinc finger A20 and AN1 domain-containing st... 101 1e-23 gb|PIN14387.1| putative Zn-finger protein [Handroanthus impetigi... 100 1e-23 gb|OWM78363.1| hypothetical protein CDL15_Pgr016087 [Punica gran... 100 1e-23 gb|PHT93552.1| Zinc finger A20 and AN1 domain-containing stress-... 97 2e-23 gb|ACM68451.1| stress-associated protein 1, partial [Solanum pen... 97 2e-23 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] >gi|... 97 2e-23 ref|XP_011093526.1| zinc finger A20 and AN1 domain-containing st... 99 4e-23 ref|XP_011087429.1| zinc finger A20 and AN1 domain-containing st... 98 8e-23 ref|XP_012849801.1| PREDICTED: zinc finger A20 and AN1 domain-co... 98 1e-22 ref|XP_012844705.1| PREDICTED: zinc finger A20 and AN1 domain-co... 98 1e-22 >ref|XP_023729765.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Lactuca sativa] Length = 154 Score = 109 bits (272), Expect = 2e-27 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = +2 Query: 239 NILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 N LKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK Sbjct: 85 NRLKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 132 >gb|KVH90830.1| Zinc finger, AN1-type [Cynara cardunculus var. scolymus] Length = 154 Score = 107 bits (268), Expect = 7e-27 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = +2 Query: 239 NILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 N KRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK Sbjct: 85 NRFKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 132 >gb|PLY76967.1| hypothetical protein LSAT_6X48240 [Lactuca sativa] Length = 226 Score = 109 bits (272), Expect = 1e-26 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = +2 Query: 239 NILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 N LKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK Sbjct: 85 NRLKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 132 >gb|KVI09450.1| Zinc finger, AN1-type [Cynara cardunculus var. scolymus] Length = 159 Score = 106 bits (265), Expect = 2e-26 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 239 NILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 N LKRREVNRCSGC+RKVGLMGFRCRCGEMFCS+HRYSDRHDCSYDYK Sbjct: 90 NRLKRREVNRCSGCKRKVGLMGFRCRCGEMFCSEHRYSDRHDCSYDYK 137 >gb|AMB19672.1| putative A20/AN1-like zinc finger family protein 1 [Taraxacum kok-saghyz] Length = 161 Score = 104 bits (259), Expect = 2e-25 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = +2 Query: 239 NILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 N+ K+REVNRCSGC+RKVGLMGFRCRCG+MFCS+HRYSDRHDCSYDYK Sbjct: 86 NMFKKREVNRCSGCKRKVGLMGFRCRCGDMFCSEHRYSDRHDCSYDYK 133 >ref|XP_023733256.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Lactuca sativa] gb|PLY74254.1| hypothetical protein LSAT_1X66321 [Lactuca sativa] Length = 142 Score = 102 bits (253), Expect = 9e-25 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = +2 Query: 236 ENILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +N KRR++NRCSGCR+KVGLMGFRCRCGEMFCS+HRY+DRHDCSYDYK Sbjct: 72 DNRTKRRQLNRCSGCRKKVGLMGFRCRCGEMFCSEHRYTDRHDCSYDYK 120 >ref|XP_023751481.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Lactuca sativa] gb|PLY94838.1| hypothetical protein LSAT_2X100821 [Lactuca sativa] Length = 155 Score = 102 bits (254), Expect = 9e-25 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = +2 Query: 239 NILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 ++ K+REVNRCSGC+RKVGLMGFRCRCGEMFCS+HRYSDRHDC+YDYK Sbjct: 86 DMFKKREVNRCSGCKRKVGLMGFRCRCGEMFCSEHRYSDRHDCNYDYK 133 >ref|XP_022896572.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Olea europaea var. sylvestris] Length = 165 Score = 101 bits (252), Expect = 2e-24 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +2 Query: 236 ENILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 E +L +REVNRCSGCRRKVGL GFRCRCGE+FC+DHRYSDRHDCSYDYK Sbjct: 95 EVVLVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK 143 >gb|KVI00229.1| Zinc finger, AN1-type [Cynara cardunculus var. scolymus] Length = 172 Score = 101 bits (252), Expect = 3e-24 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +2 Query: 248 KRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 KRR+VNRCSGCRRKVGL GFRCRCGEMFCS+HRYSDRHDCSYDYK Sbjct: 85 KRRDVNRCSGCRRKVGLTGFRCRCGEMFCSEHRYSDRHDCSYDYK 129 >ref|XP_022865224.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Olea europaea var. sylvestris] Length = 165 Score = 100 bits (250), Expect = 5e-24 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +2 Query: 236 ENILKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYKGKPEHLFT 406 E +L +REVNRCSGCRRKVGL GFRCRCGE+FC+DHRY+DRHDCSYDYK T Sbjct: 95 EVVLLKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYTDRHDCSYDYKAAGREAIT 151 >ref|XP_022001154.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Helianthus annuus] gb|OTG01627.1| putative zinc finger, AN1-type [Helianthus annuus] Length = 234 Score = 101 bits (252), Expect = 1e-23 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +2 Query: 245 LKRREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +KRR +NRCSGCRRKVGLMGFRCRCGE FCSDHRYSDRHDCSYDYK Sbjct: 167 VKRRVINRCSGCRRKVGLMGFRCRCGETFCSDHRYSDRHDCSYDYK 212 >gb|PIN14387.1| putative Zn-finger protein [Handroanthus impetiginosus] Length = 177 Score = 100 bits (248), Expect = 1e-23 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 RREVNRCSGCRRKVGL GFRCRCGE+FC+DHRYSDRHDCSYDYK Sbjct: 112 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK 155 >gb|OWM78363.1| hypothetical protein CDL15_Pgr016087 [Punica granatum] gb|PKI31656.1| hypothetical protein CRG98_047940 [Punica granatum] Length = 181 Score = 100 bits (248), Expect = 1e-23 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 RREVNRCSGCRRKVGL GFRCRCGE+FC+DHRYSDRHDCSYDYK Sbjct: 116 RREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK 159 >gb|PHT93552.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum annuum] Length = 86 Score = 97.1 bits (240), Expect = 2e-23 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +REVNRCSGCRRKVGL GFRCRCGE+FC +HRYSDRHDCSYDYK Sbjct: 23 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK 66 >gb|ACM68451.1| stress-associated protein 1, partial [Solanum pennellii] Length = 87 Score = 97.1 bits (240), Expect = 2e-23 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +REVNRCSGCRRKVGL GFRCRCGE+FC +HRYSDRHDCSYDYK Sbjct: 22 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK 65 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] gb|PHT59116.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum baccatum] gb|PHU30166.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum chinense] Length = 88 Score = 97.1 bits (240), Expect = 2e-23 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +REVNRCSGCRRKVGL GFRCRCGE+FC +HRYSDRHDCSYDYK Sbjct: 23 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK 66 >ref|XP_011093526.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5 [Sesamum indicum] Length = 177 Score = 99.0 bits (245), Expect = 4e-23 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +REVNRCSGCRRKVGL GFRCRCGE+FC+DHRYSDRHDCSYDYK Sbjct: 112 KREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK 155 >ref|XP_011087429.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Sesamum indicum] Length = 170 Score = 97.8 bits (242), Expect = 8e-23 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +R+VNRCSGCRRKVGL GFRCRCGE+FC+DHRYSDRHDCSYDYK Sbjct: 105 KRQVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK 148 >ref|XP_012849801.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata] Length = 178 Score = 97.8 bits (242), Expect = 1e-22 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +REVNRCSGCRRKVGL GFRCRCG++FC+DHRYSDRHDCSYDYK Sbjct: 113 KREVNRCSGCRRKVGLTGFRCRCGDLFCADHRYSDRHDCSYDYK 156 >ref|XP_012844705.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata] Length = 179 Score = 97.8 bits (242), Expect = 1e-22 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 251 RREVNRCSGCRRKVGLMGFRCRCGEMFCSDHRYSDRHDCSYDYK 382 +REVNRC+GCRRKVGL GFRCRCGE+FC+DHRYSDRHDCSYDYK Sbjct: 114 KREVNRCTGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYK 157