BLASTX nr result
ID: Chrysanthemum22_contig00002796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00002796 (796 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY85762.1| hypothetical protein LSAT_1X41161 [Lactuca sativa] 59 2e-06 >gb|PLY85762.1| hypothetical protein LSAT_1X41161 [Lactuca sativa] Length = 484 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 425 VIVAVGFMN*RLEIPKDMDSLWALLIKNCWCRLVS 321 VI AVGFMN RLEIPKD+D LWA LI++CWCR VS Sbjct: 403 VIGAVGFMNRRLEIPKDVDPLWAFLIESCWCRNVS 437