BLASTX nr result
ID: Chrysanthemum22_contig00002316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00002316 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI06909.1| hypothetical protein Ccrd_014734 [Cynara carduncu... 78 1e-15 ref|XP_023756641.1| glutamyl-tRNA(Gln) amidotransferase subunit ... 76 1e-14 ref|XP_022022080.1| glutamyl-tRNA(Gln) amidotransferase subunit ... 72 7e-13 >gb|KVI06909.1| hypothetical protein Ccrd_014734 [Cynara cardunculus var. scolymus] Length = 123 Score = 78.2 bits (191), Expect = 1e-15 Identities = 39/58 (67%), Positives = 46/58 (79%) Frame = +2 Query: 299 MGSRALVLLAPVVLSERSLLNQLSKCGFHQALRQKDNRLRVGVRDYSVHSSLERPNVA 472 MGSRAL+LLAP L++R L+N S GF QA R K+ LRVGVR+YSVHSSLERPNV+ Sbjct: 1 MGSRALLLLAPAFLADRILVNHFSISGFRQAFRPKEEMLRVGVRNYSVHSSLERPNVS 58 >ref|XP_023756641.1| glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial [Lactuca sativa] ref|XP_023756642.1| glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial [Lactuca sativa] gb|PLY90738.1| hypothetical protein LSAT_3X27161 [Lactuca sativa] Length = 146 Score = 76.3 bits (186), Expect = 1e-14 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = +2 Query: 299 MGSRALVLLAPVVLSERSLLNQLSKCGFHQALRQKDNRLRVGVRDYSVHSSLERPNV 469 MGSRAL++LAP LSE LLN +S+ GFHQ L Q + R+RVG R+YS+HS+LERP+V Sbjct: 1 MGSRALLVLAPAFLSESILLNHISRSGFHQLLTQNEKRVRVGGRNYSIHSNLERPDV 57 >ref|XP_022022080.1| glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial [Helianthus annuus] ref|XP_022022081.1| glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial [Helianthus annuus] Length = 146 Score = 71.6 bits (174), Expect = 7e-13 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = +2 Query: 299 MGSRALVLLAPVVLSERSLLNQLSKCGFHQALRQKDNRLRVGVRDYSVHSSLERPNVA 472 MGSR L+LL+P S+ LL+Q +K GFHQ +RQ + +R GVR YSVHSSLERP+VA Sbjct: 1 MGSRVLLLLSPAFRSDHVLLSQFTKYGFHQTVRQTEKMVRGGVRKYSVHSSLERPDVA 58