BLASTX nr result
ID: Chrysanthemum22_contig00002121
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00002121 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022036431.1| zinc finger protein ZAT10-like [Helianthus a... 73 6e-13 ref|XP_023755768.1| zinc finger protein ZAT10-like [Lactuca sati... 72 2e-12 gb|KVI10822.1| Zinc finger, C2H2 [Cynara cardunculus var. scolymus] 66 4e-10 ref|XP_009772006.1| PREDICTED: zinc finger protein ZAT10-like [N... 65 1e-09 ref|XP_019240274.1| PREDICTED: zinc finger protein ZAT10-like [N... 65 1e-09 ref|XP_016477119.1| PREDICTED: zinc finger protein ZAT10-like [N... 65 2e-09 ref|XP_022017536.1| zinc finger protein ZAT10-like [Helianthus a... 64 3e-09 ref|XP_023771916.1| zinc finger protein ZAT10-like [Lactuca sati... 64 3e-09 gb|AAC06243.1| osmotic stress-induced zinc-finger protein [Nicot... 64 4e-09 gb|AAU12056.1| zinc-finger protein [Solanum chacoense] 62 2e-08 gb|KVI01921.1| Zinc finger, C2H2 [Cynara cardunculus var. scolymus] 62 2e-08 ref|XP_009625229.1| PREDICTED: zinc finger protein ZAT10-like [N... 62 2e-08 ref|XP_022888193.1| zinc finger protein ZAT10-like [Olea europae... 62 3e-08 ref|XP_009784656.1| PREDICTED: zinc finger protein ZAT6-like iso... 61 4e-08 ref|XP_009784655.1| PREDICTED: zinc finger protein ZAT10-like is... 61 4e-08 ref|XP_019237682.1| PREDICTED: zinc finger protein ZAT10-like [N... 61 5e-08 ref|XP_016472823.1| PREDICTED: zinc finger protein ZAT10-like [N... 60 1e-07 ref|XP_018625967.1| PREDICTED: zinc finger protein ZAT10-like [N... 60 1e-07 dbj|BAA05078.1| zinc-finger DNA binding protein [Petunia x hybrida] 59 2e-07 gb|AHA80146.1| Cys2/His2-type zinc finger protein [Mikania micra... 59 2e-07 >ref|XP_022036431.1| zinc finger protein ZAT10-like [Helianthus annuus] gb|OTG30028.1| putative zinc finger, C2H2-like protein [Helianthus annuus] Length = 197 Score = 73.2 bits (178), Expect = 6e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +1 Query: 7 QVRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPRFS 159 Q RDFDLN PA LP F +GLS+DCGKKSQLL+ +EQEVESPLP KKPR S Sbjct: 148 QPRDFDLNFPA--LPDFHMGLSIDCGKKSQLLV-HEQEVESPLPMKKPRLS 195 >ref|XP_023755768.1| zinc finger protein ZAT10-like [Lactuca sativa] gb|PLY91492.1| hypothetical protein LSAT_7X85360 [Lactuca sativa] Length = 244 Score = 72.4 bits (176), Expect = 2e-12 Identities = 41/56 (73%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +1 Query: 7 QVRDFDLNLPAMLLPG-FQLGLSVDCGKKSQLLLANEQEVESPLPSKKPRFSTAEE 171 Q RDFDLNLPA P FQ+GLSVDCGKKSQ+L+ NEQEVESPLP KKP FS E Sbjct: 192 QPRDFDLNLPAF--PDLFQMGLSVDCGKKSQMLI-NEQEVESPLPMKKPCFSIKTE 244 >gb|KVI10822.1| Zinc finger, C2H2 [Cynara cardunculus var. scolymus] Length = 223 Score = 66.2 bits (160), Expect = 4e-10 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +1 Query: 13 RDFDLNLPAMLLPGFQLGLSVDC-GKKSQLLLANEQEVESPLPSKKPRFS 159 RDFDLNLPA P FQLGLSV+C GKKSQL + EQEVESPLP KKPR S Sbjct: 173 RDFDLNLPAF--PEFQLGLSVECSGKKSQLSM-KEQEVESPLPMKKPRLS 219 >ref|XP_009772006.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana sylvestris] Length = 272 Score = 65.5 bits (158), Expect = 1e-09 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 +RDFDLN+PA P QLGLS+DCG+KSQ LL +QEVESP+P+KKPR Sbjct: 222 LRDFDLNMPAS--PELQLGLSIDCGRKSQ-LLPMDQEVESPMPAKKPR 266 >ref|XP_019240274.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana attenuata] gb|OIT20374.1| zinc finger protein zat10 [Nicotiana attenuata] Length = 275 Score = 65.5 bits (158), Expect = 1e-09 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 +RDFDLN+PA P QLGLS+DCG+KSQLL +QEVESP+P+KKPR Sbjct: 225 LRDFDLNMPAS--PELQLGLSIDCGRKSQLLPV-DQEVESPMPAKKPR 269 >ref|XP_016477119.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana tabacum] Length = 275 Score = 65.1 bits (157), Expect = 2e-09 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 +RDFDLN+PA P QLGLS+DCG+KSQ LL +QEVESP+P+KKPR Sbjct: 225 LRDFDLNMPAS--PELQLGLSIDCGRKSQ-LLPIDQEVESPMPAKKPR 269 >ref|XP_022017536.1| zinc finger protein ZAT10-like [Helianthus annuus] gb|OTF91304.1| putative zinc finger, C2H2-like protein [Helianthus annuus] Length = 209 Score = 63.5 bits (153), Expect = 3e-09 Identities = 37/52 (71%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = +1 Query: 7 QVRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLP-SKKPRFS 159 Q RDFDLNLPA P FQ+GL+VD GKKSQL + +EQEVESPLP KKPR S Sbjct: 160 QPRDFDLNLPAF--PDFQVGLTVDIGKKSQLSV-HEQEVESPLPIKKKPRLS 208 >ref|XP_023771916.1| zinc finger protein ZAT10-like [Lactuca sativa] gb|PLY79258.1| hypothetical protein LSAT_9X111840 [Lactuca sativa] Length = 269 Score = 64.3 bits (155), Expect = 3e-09 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +1 Query: 7 QVRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPRFSTAEEI 174 Q R FDLNLPA P FQLGLSVDC KKSQL + +EQEVESP P+KK S A ++ Sbjct: 214 QPRGFDLNLPAF--PEFQLGLSVDCAKKSQLFM-SEQEVESPHPAKKQLLSVAVDL 266 >gb|AAC06243.1| osmotic stress-induced zinc-finger protein [Nicotiana tabacum] Length = 273 Score = 63.9 bits (154), Expect = 4e-09 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 +RDFDLN+PA P QLGLS+DCG+KSQ LL QEVESP+P+KKPR Sbjct: 223 LRDFDLNMPAS--PELQLGLSIDCGRKSQ-LLPMVQEVESPMPAKKPR 267 >gb|AAU12056.1| zinc-finger protein [Solanum chacoense] Length = 273 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +1 Query: 13 RDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 RDFDLN+PA LPG+QL L++DCG +SQ + EQEVESP+P+KKPR Sbjct: 227 RDFDLNMPA--LPGWQLDLTIDCGGRSQFPI--EQEVESPMPAKKPR 269 >gb|KVI01921.1| Zinc finger, C2H2 [Cynara cardunculus var. scolymus] Length = 258 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = +1 Query: 7 QVRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 Q R+FDLNLPA P FQLGL+VDC KKSQL NEQEVESP P+KK R Sbjct: 202 QPRNFDLNLPAF--PEFQLGLNVDCVKKSQLSF-NEQEVESPHPAKKQR 247 >ref|XP_009625229.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana tomentosiformis] Length = 272 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 +RDFDLN+PA P QLGLS+DC +KSQ LL +QEVESP+P+KKPR Sbjct: 222 LRDFDLNMPAS--PELQLGLSIDCERKSQ-LLPIDQEVESPMPAKKPR 266 >ref|XP_022888193.1| zinc finger protein ZAT10-like [Olea europaea var. sylvestris] Length = 273 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = +1 Query: 13 RDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPRFSTAEE 171 RDFDLNLPA P F L L+VDC KKSQ L EQEVESP+P KKPR EE Sbjct: 224 RDFDLNLPAT--PEFPLQLTVDCEKKSQFL--GEQEVESPMPFKKPRLPLFEE 272 >ref|XP_009784656.1| PREDICTED: zinc finger protein ZAT6-like isoform X2 [Nicotiana sylvestris] Length = 256 Score = 61.2 bits (147), Expect = 4e-08 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 VRDFDLNLP P F LGL+VDC KSQL ++EQEVESP+P+KKPR Sbjct: 208 VRDFDLNLPPP--PEFSLGLTVDCEGKSQL--SSEQEVESPMPTKKPR 251 >ref|XP_009784655.1| PREDICTED: zinc finger protein ZAT10-like isoform X1 [Nicotiana sylvestris] Length = 289 Score = 61.2 bits (147), Expect = 4e-08 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 VRDFDLNLP P F LGL+VDC KSQL ++EQEVESP+P+KKPR Sbjct: 241 VRDFDLNLPPP--PEFSLGLTVDCEGKSQL--SSEQEVESPMPTKKPR 284 >ref|XP_019237682.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana attenuata] gb|OIT22250.1| zinc finger protein zat10 [Nicotiana attenuata] Length = 304 Score = 61.2 bits (147), Expect = 5e-08 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 VRDFDLNLP P F LGL+VDC KSQL ++EQEVESP+P+KKPR Sbjct: 256 VRDFDLNLPPP--PEFSLGLTVDCEGKSQL--SSEQEVESPMPTKKPR 299 >ref|XP_016472823.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana tabacum] Length = 262 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 VRDFDLNLP P F LGL+VDC KSQL ++E+EVESP+P+KKPR Sbjct: 214 VRDFDLNLPPP--PEFSLGLTVDCRGKSQL--SSEREVESPMPTKKPR 257 >ref|XP_018625967.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana tomentosiformis] Length = 262 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +1 Query: 10 VRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPR 153 VRDFDLNLP P F LGL+VDC KSQL ++E+EVESP+P+KKPR Sbjct: 214 VRDFDLNLPPP--PEFSLGLTVDCRGKSQL--SSEREVESPMPTKKPR 257 >dbj|BAA05078.1| zinc-finger DNA binding protein [Petunia x hybrida] Length = 253 Score = 59.3 bits (142), Expect = 2e-07 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +1 Query: 13 RDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPRFS 159 RDFDLNLP P LG+SVDC +KSQL + EQEVESP+P+KKPR + Sbjct: 203 RDFDLNLPPS--PELTLGMSVDCERKSQL--SGEQEVESPMPTKKPRLA 247 >gb|AHA80146.1| Cys2/His2-type zinc finger protein [Mikania micrantha] Length = 271 Score = 59.3 bits (142), Expect = 2e-07 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +1 Query: 7 QVRDFDLNLPAMLLPGFQLGLSVDCGKKSQLLLANEQEVESPLPSKKPRFSTAEEI 174 Q RDFDLNLPA P F LGL +D KK QL + +EQEVESP P+KK R S A ++ Sbjct: 216 QPRDFDLNLPAF--PEFHLGLKIDFVKKGQLFI-HEQEVESPHPAKKQRLSVAGDV 268