BLASTX nr result
ID: Chrysanthemum22_contig00001823
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00001823 (603 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY72220.1| hypothetical protein LSAT_7X40980 [Lactuca sativa] 55 4e-06 >gb|PLY72220.1| hypothetical protein LSAT_7X40980 [Lactuca sativa] Length = 150 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/74 (35%), Positives = 41/74 (55%) Frame = -3 Query: 601 IKINYAAKQTIIYSRSKEVLSKEDEDALERFEENFDSLEGIFKSASPEFKKELCKRLSEE 422 I++NYA+K +IYS + ++ E A+E FE+ FD+ S + KK+LC + Sbjct: 71 IRVNYASKTFVIYSLTDSEITPEALKAIETFEQPFDNFSHHLAELSTDLKKQLCNHIM-H 129 Query: 421 SPRHKCKFCAQTPE 380 +PRH C C + E Sbjct: 130 APRHNCSHCKENIE 143