BLASTX nr result
ID: Chrysanthemum22_contig00001533
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00001533 (691 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY84453.1| hypothetical protein LSAT_7X53061 [Lactuca sativa] 89 2e-19 ref|XP_022751634.1| uncharacterized protein LOC111300264 [Durio ... 54 5e-06 >gb|PLY84453.1| hypothetical protein LSAT_7X53061 [Lactuca sativa] Length = 88 Score = 89.4 bits (220), Expect = 2e-19 Identities = 44/62 (70%), Positives = 52/62 (83%) Frame = -3 Query: 575 LFNRNENRKSMERKLRQLQRIVPGGRVEPSDLDTLFHRVAAHIFLLESRVDLLKNAYSLF 396 +F N+NRKSMERKLRQLQRI+PGG VE D++TLF R+ AHI LLESRVDLL++ SLF Sbjct: 26 VFKINDNRKSMERKLRQLQRIIPGGGVEGIDMETLFQRIEAHISLLESRVDLLRSICSLF 85 Query: 395 SP 390 SP Sbjct: 86 SP 87 >ref|XP_022751634.1| uncharacterized protein LOC111300264 [Durio zibethinus] Length = 100 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -3 Query: 554 RKSMERKLRQLQRIVPGGRVEPSDLDTLFHRVAAHIFLLESRVDLLKN 411 R S+ERKLRQLQR++P G E +++TLF R A HIFLLE++V L+N Sbjct: 47 RTSIERKLRQLQRMLPAGCAE-INMETLFQRTAEHIFLLEAKVRSLQN 93