BLASTX nr result
ID: Chrysanthemum22_contig00001522
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00001522 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021999949.1| uncharacterized protein LOC110897511 [Helian... 57 5e-07 gb|KVI02139.1| Ysc84 actin-binding domain-containing protein [Cy... 55 3e-06 >ref|XP_021999949.1| uncharacterized protein LOC110897511 [Helianthus annuus] gb|OTG00321.1| putative RING/FYVE/PHD-type zinc finger family protein [Helianthus annuus] Length = 538 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 1 IKTSDVLLG*LPRPPGAKILYDALSELYMKVER 99 IKT D+LLG LPRPP A ILYDALSELYMKVER Sbjct: 505 IKTFDILLGSLPRPPAAAILYDALSELYMKVER 537 >gb|KVI02139.1| Ysc84 actin-binding domain-containing protein [Cynara cardunculus var. scolymus] Length = 509 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 1 IKTSDVLLG*LPRPPGAKILYDALSELYMKVER 99 IKTSD+LLG LPRPP A ILYDALS+LYMKV R Sbjct: 476 IKTSDILLGSLPRPPAAAILYDALSKLYMKVGR 508