BLASTX nr result
ID: Chrysanthemum22_contig00001186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00001186 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPR93174.1| hypothetical protein GOBAR_AA27497 [Gossypium bar... 59 5e-09 gb|ACJ85451.1| unknown [Medicago truncatula] 60 9e-09 ref|XP_015875525.1| PREDICTED: protein transport protein Sec61 s... 62 1e-08 ref|XP_015170142.1| PREDICTED: protein transport protein Sec61 s... 62 1e-08 ref|XP_010060738.1| PREDICTED: protein transport protein Sec61 s... 60 1e-08 gb|KMT02322.1| hypothetical protein BVRB_9g205470 [Beta vulgaris... 59 1e-08 gb|PKI66843.1| hypothetical protein CRG98_012849 [Punica granatum] 60 1e-08 ref|XP_008452137.1| PREDICTED: protein transport protein Sec61 s... 60 1e-08 ref|XP_016901148.1| PREDICTED: protein transport protein Sec61 s... 60 1e-08 ref|XP_017613950.1| PREDICTED: protein transport protein Sec61 s... 60 2e-08 gb|AAK94784.1| Sec61 alpha subunit [Hordeum vulgare] 61 2e-08 ref|XP_021733620.1| protein transport protein Sec61 subunit alph... 61 2e-08 ref|XP_020146398.1| protein transport protein Sec61 subunit alph... 61 2e-08 ref|XP_004146019.1| PREDICTED: protein transport protein Sec61 s... 61 2e-08 ref|XP_016463099.1| PREDICTED: protein transport protein Sec61 s... 59 3e-08 ref|XP_010091059.2| protein transport protein Sec61 subunit alph... 60 3e-08 gb|KDO77926.1| hypothetical protein CISIN_1g011896mg [Citrus sin... 60 3e-08 gb|EXC36706.1| Protein transport protein Sec61 subunit alpha [Mo... 60 3e-08 gb|ESQ33941.1| hypothetical protein EUTSA_v10007527mg [Eutrema s... 60 3e-08 gb|PKI52771.1| hypothetical protein CRG98_026846 [Punica granatum] 60 3e-08 >gb|PPR93174.1| hypothetical protein GOBAR_AA27497 [Gossypium barbadense] Length = 77 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 297 LPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 6 LPLYGIHSTTGADPFYWMRVILASNRGTVMELG 38 >gb|ACJ85451.1| unknown [Medicago truncatula] Length = 188 Score = 60.5 bits (145), Expect = 9e-09 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >ref|XP_015875525.1| PREDICTED: protein transport protein Sec61 subunit alpha-like [Ziziphus jujuba] ref|XP_015875533.1| PREDICTED: protein transport protein Sec61 subunit alpha-like [Ziziphus jujuba] Length = 475 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMRAIL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRAILASNRGTVMELG 82 >ref|XP_015170142.1| PREDICTED: protein transport protein Sec61 subunit alpha [Solanum tuberosum] ref|XP_015170143.1| PREDICTED: protein transport protein Sec61 subunit alpha [Solanum tuberosum] Length = 475 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMRAIL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRAILASNRGTVMELG 82 >ref|XP_010060738.1| PREDICTED: protein transport protein Sec61 subunit alpha [Eucalyptus grandis] gb|KCW67566.1| hypothetical protein EUGRSUZ_F01316 [Eucalyptus grandis] Length = 191 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >gb|KMT02322.1| hypothetical protein BVRB_9g205470 [Beta vulgaris subsp. vulgaris] Length = 115 Score = 58.5 bits (140), Expect = 1e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELGYFS 190 +L+ ++ LPLYGI+S TGA PFYWMR IL S+RG VMELG S Sbjct: 40 SLFIFLVCSKLPLYGIHSTTGADPFYWMRVILASSRGTVMELGITS 85 >gb|PKI66843.1| hypothetical protein CRG98_012849 [Punica granatum] Length = 191 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 324 LYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 41 LFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >ref|XP_008452137.1| PREDICTED: protein transport protein Sec61 subunit alpha-like, partial [Cucumis melo] Length = 194 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 324 LYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 41 LFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >ref|XP_016901148.1| PREDICTED: protein transport protein Sec61 subunit alpha-like, partial [Cucumis melo] Length = 194 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 324 LYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 41 LFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >ref|XP_017613950.1| PREDICTED: protein transport protein Sec61 subunit alpha-like [Gossypium arboreum] Length = 241 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >gb|AAK94784.1| Sec61 alpha subunit [Hordeum vulgare] Length = 475 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYW+RAIL SNRG+VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWLRAILASNRGSVMELG 82 >ref|XP_021733620.1| protein transport protein Sec61 subunit alpha-like [Chenopodium quinoa] Length = 475 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFVFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >ref|XP_020146398.1| protein transport protein Sec61 subunit alpha-like [Aegilops tauschii subsp. tauschii] gb|EMS53662.1| Protein transport protein Sec61 subunit alpha [Triticum urartu] Length = 475 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYW+RAIL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWLRAILASNRGTVMELG 82 >ref|XP_004146019.1| PREDICTED: protein transport protein Sec61 subunit alpha [Cucumis sativus] gb|KGN55053.1| hypothetical protein Csa_4G625570 [Cucumis sativus] Length = 476 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFVFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >ref|XP_016463099.1| PREDICTED: protein transport protein Sec61 subunit alpha-like [Nicotiana tabacum] Length = 191 Score = 59.3 bits (142), Expect = 3e-08 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 312 IILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 45 LVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >ref|XP_010091059.2| protein transport protein Sec61 subunit alpha, partial [Morus notabilis] Length = 309 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >gb|KDO77926.1| hypothetical protein CISIN_1g011896mg [Citrus sinensis] Length = 314 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >gb|EXC36706.1| Protein transport protein Sec61 subunit alpha [Morus notabilis] Length = 326 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >gb|ESQ33941.1| hypothetical protein EUTSA_v10007527mg [Eutrema salsugineum] Length = 351 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >gb|PKI52771.1| hypothetical protein CRG98_026846 [Punica granatum] Length = 352 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 327 NLYPSIILVHLPLYGINSPTGAIPFYWMRAILDSNRGNVMELG 199 +L+ ++ LPLYGI+S TGA PFYWMR IL SNRG VMELG Sbjct: 40 SLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82