BLASTX nr result
ID: Chrysanthemum22_contig00001184
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00001184 (969 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPR93174.1| hypothetical protein GOBAR_AA27497 [Gossypium bar... 54 5e-06 gb|ACJ85451.1| unknown [Medicago truncatula] 57 7e-06 ref|XP_010060738.1| PREDICTED: protein transport protein Sec61 s... 57 7e-06 emb|CDY43687.1| BnaA04g20040D, partial [Brassica napus] 59 7e-06 gb|KMT02322.1| hypothetical protein BVRB_9g205470 [Beta vulgaris... 55 8e-06 >gb|PPR93174.1| hypothetical protein GOBAR_AA27497 [Gossypium barbadense] Length = 77 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 205 LPLYGINSPTGAIPFSWMRAILGSNRGNAMELG 107 LPLYGI+S TGA PF WMR IL SNRG MELG Sbjct: 6 LPLYGIHSTTGADPFYWMRVILASNRGTVMELG 38 >gb|ACJ85451.1| unknown [Medicago truncatula] Length = 188 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -3 Query: 238 LNLYPTIIFVHLPLYGINSPTGAIPFSWMRAILGSNRGNAMELG 107 ++L+ ++ LPLYGI+S TGA PF WMR IL SNRG MELG Sbjct: 39 ISLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >ref|XP_010060738.1| PREDICTED: protein transport protein Sec61 subunit alpha [Eucalyptus grandis] gb|KCW67566.1| hypothetical protein EUGRSUZ_F01316 [Eucalyptus grandis] Length = 191 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -3 Query: 238 LNLYPTIIFVHLPLYGINSPTGAIPFSWMRAILGSNRGNAMELG 107 ++L+ ++ LPLYGI+S TGA PF WMR IL SNRG MELG Sbjct: 39 ISLFIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 82 >emb|CDY43687.1| BnaA04g20040D, partial [Brassica napus] Length = 452 Score = 58.5 bits (140), Expect = 7e-06 Identities = 32/56 (57%), Positives = 35/56 (62%), Gaps = 6/56 (10%) Frame = -3 Query: 256 PYRHFCLN---LYPTIIFV---HLPLYGINSPTGAIPFSWMRAILGSNRGNAMELG 107 P CLN P +IF+ LPLYGI+S TGA PF WMR IL SNRG MELG Sbjct: 4 PMSQHCLNREEALPFLIFLVCSQLPLYGIHSTTGADPFYWMRVILASNRGTVMELG 59 >gb|KMT02322.1| hypothetical protein BVRB_9g205470 [Beta vulgaris subsp. vulgaris] Length = 115 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 9/68 (13%) Frame = -3 Query: 283 LFFIPTLSD-----PYR----HFCLNLYPTIIFVHLPLYGINSPTGAIPFSWMRAILGSN 131 L F+P + P+R + ++L+ ++ LPLYGI+S TGA PF WMR IL S+ Sbjct: 15 LSFVPEVQSADRKVPFREKVIYTVISLFIFLVCSKLPLYGIHSTTGADPFYWMRVILASS 74 Query: 130 RGNAMELG 107 RG MELG Sbjct: 75 RGTVMELG 82