BLASTX nr result
ID: Chrysanthemum22_contig00000818
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00000818 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI11908.1| hypothetical protein Ccrd_009686 [Cynara carduncu... 97 5e-21 ref|YP_004891598.1| unnamed protein product (chloroplast) [Nicot... 54 4e-08 ref|NP_054493.1| hypothetical protein NitaCp017 [Nicotiana tabac... 46 8e-06 >gb|KVI11908.1| hypothetical protein Ccrd_009686 [Cynara cardunculus var. scolymus] Length = 367 Score = 97.4 bits (241), Expect = 5e-21 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = +3 Query: 135 VNGVGGEQNLVFYFTNGHAESYIYPYSGIDRLTITPEIFDSGGIHSYGHV 284 V+GVGGE NLVFYFTNGHA SYIYPY GIDRLTITPEIFDS GIHSYGHV Sbjct: 222 VHGVGGEWNLVFYFTNGHAGSYIYPYIGIDRLTITPEIFDSDGIHSYGHV 271 >ref|YP_004891598.1| unnamed protein product (chloroplast) [Nicotiana undulata] gb|AEO95557.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95667.1| hypothetical protein [synthetic construct] Length = 107 Score = 53.9 bits (128), Expect(3) = 4e-08 Identities = 34/76 (44%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Frame = +3 Query: 30 IVLKYIIQGFYHESIDSXXXXXXXXXXXXXXXXXXVNGVGGEQNLVFYFTNGHAESYIYP 209 IV+KY+I+GFY I + +GVGG+ N +FYFTNGHA SYI Sbjct: 16 IVIKYVIEGFYF--IMNPLILYDLLLLPLSHFIRTWSGVGGKWNFIFYFTNGHARSYI-- 71 Query: 210 YSGIDRLT--ITPEIF 251 Y IDR T PEIF Sbjct: 72 YIRIDRSTGGFAPEIF 87 Score = 27.7 bits (60), Expect(3) = 4e-08 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 253 IVAVSTHMAMFYSEE 297 IV VST MAMFYSEE Sbjct: 93 IVGVSTPMAMFYSEE 107 Score = 23.1 bits (48), Expect(3) = 4e-08 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 IPFDPYISQKL 33 IPFDP ISQK+ Sbjct: 4 IPFDPSISQKI 14 >ref|NP_054493.1| hypothetical protein NitaCp017 [Nicotiana tabacum] ref|YP_358670.1| hypothetical protein NisyCp023 [Nicotiana sylvestris] emb|CAA77348.1| hypothetical protein (chloroplast) [Nicotiana tabacum] dbj|BAE46645.1| hypothetical protein (chloroplast) [Nicotiana sylvestris] gb|AMM05540.1| hypothetical protein (plastid) [Nicotiana tabacum] prf||1211235X ORF 105 Length = 105 Score = 45.8 bits (107), Expect(3) = 8e-06 Identities = 31/76 (40%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = +3 Query: 30 IVLKYIIQGFYHESIDSXXXXXXXXXXXXXXXXXXVNGVGGEQNLVFYFTNGHAESYIYP 209 IV+KY+I+GFY GG+ N +FYFTNGHA SYI Sbjct: 16 IVIKYVIEGFYF----IMNPLILYDLLLLPLSHFIRTWSGGKWNFIFYFTNGHARSYI-- 69 Query: 210 YSGIDRLT--ITPEIF 251 Y IDR T PEIF Sbjct: 70 YIRIDRSTGGFAPEIF 85 Score = 27.7 bits (60), Expect(3) = 8e-06 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 253 IVAVSTHMAMFYSEE 297 IV VST MAMFYSEE Sbjct: 91 IVGVSTPMAMFYSEE 105 Score = 23.1 bits (48), Expect(3) = 8e-06 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 IPFDPYISQKL 33 IPFDP ISQK+ Sbjct: 4 IPFDPSISQKI 14