BLASTX nr result
ID: Chrysanthemum22_contig00000511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00000511 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023741015.1| 30S ribosomal protein S21, chloroplastic [La... 72 4e-13 gb|KVI09217.1| Ribosomal protein S21 [Cynara cardunculus var. sc... 70 3e-12 ref|XP_021973485.1| 30S ribosomal protein S21, chloroplastic-lik... 65 2e-10 ref|XP_022005581.1| 30S ribosomal protein S21, chloroplastic-lik... 64 1e-09 >ref|XP_023741015.1| 30S ribosomal protein S21, chloroplastic [Lactuca sativa] gb|PLY96781.1| hypothetical protein LSAT_2X94161 [Lactuca sativa] Length = 176 Score = 72.4 bits (176), Expect = 4e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 348 TPFRNPNDDKVEGVNKKREDDNDNWEMPNDSPLN 247 TPFRNPNDDKVE VNKKREDD+DNW+MP+DSPLN Sbjct: 143 TPFRNPNDDKVESVNKKREDDDDNWDMPSDSPLN 176 >gb|KVI09217.1| Ribosomal protein S21 [Cynara cardunculus var. scolymus] Length = 177 Score = 70.1 bits (170), Expect = 3e-12 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -1 Query: 348 TPFRNPNDDKVEGVNKKREDDNDNWEMPNDSPLN 247 TPFRNPND+K+EGV+KKREDD+DNW+MP+DSPLN Sbjct: 144 TPFRNPNDEKLEGVSKKREDDDDNWDMPSDSPLN 177 >ref|XP_021973485.1| 30S ribosomal protein S21, chloroplastic-like [Helianthus annuus] gb|OTG20905.1| putative ribosomal protein S21 [Helianthus annuus] Length = 167 Score = 65.5 bits (158), Expect = 2e-10 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 345 PFRNPNDDKVEGVNKKREDDNDNWEMPNDSPLN 247 PFRN NDDK E VNKKR+DDNDNWEMP DSPLN Sbjct: 135 PFRNFNDDKAETVNKKRDDDNDNWEMPEDSPLN 167 >ref|XP_022005581.1| 30S ribosomal protein S21, chloroplastic-like [Helianthus annuus] gb|OTF98898.1| putative ribosomal protein S21 family protein [Helianthus annuus] Length = 179 Score = 63.5 bits (153), Expect = 1e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 345 PFRNPNDDKVEGVNKKREDDNDNWEMPNDSPLN 247 PFRN ND+K E VNKK++DDNDNWEMP DSPLN Sbjct: 147 PFRNFNDEKTESVNKKKDDDNDNWEMPEDSPLN 179