BLASTX nr result
ID: Chrysanthemum22_contig00000397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00000397 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023756422.1| zinc finger CCCH domain-containing protein 3... 64 3e-09 ref|XP_017244366.1| PREDICTED: zinc finger CCCH domain-containin... 55 2e-06 >ref|XP_023756422.1| zinc finger CCCH domain-containing protein 3-like [Lactuca sativa] gb|PLY90959.1| hypothetical protein LSAT_9X106160 [Lactuca sativa] Length = 418 Score = 63.9 bits (154), Expect = 3e-09 Identities = 43/92 (46%), Positives = 44/92 (47%), Gaps = 7/92 (7%) Frame = -1 Query: 380 GICKFGPTCKYDHPLMGYSYNYGXXXXXXXXXXXXSVFPYGG----TFHXXXXXXXXXXK 213 GICKFGPTCKYDHPLMGYSYNY S+FPYGG T H K Sbjct: 328 GICKFGPTCKYDHPLMGYSYNYS-MSLPNPPILDPSLFPYGGVNSSTLHSSGSSPSKSSK 386 Query: 212 YAGAKT---XXXXXXXXXXXXXQHGASPSHSE 126 GAKT Q ASPSHSE Sbjct: 387 NEGAKTPAGPSPSPSPSPSPSPQRVASPSHSE 418 >ref|XP_017244366.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like [Daucus carota subsp. sativus] Length = 419 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/23 (86%), Positives = 23/23 (100%) Frame = -1 Query: 380 GICKFGPTCKYDHPLMGYSYNYG 312 G+CKFGPTCK+DHPL+GYSYNYG Sbjct: 320 GLCKFGPTCKFDHPLVGYSYNYG 342