BLASTX nr result
ID: Chrysanthemum22_contig00000134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00000134 (699 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY81512.1| hypothetical protein LSAT_8X106200 [Lactuca sativa] 69 1e-10 >gb|PLY81512.1| hypothetical protein LSAT_8X106200 [Lactuca sativa] Length = 189 Score = 68.9 bits (167), Expect = 1e-10 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -1 Query: 684 KRESSQTGGSSVVFEGA-DVQEFVGMSLVGKNFRKFYPNAYYKEKD 550 +RE SQTGGSS +G+ D EFVGMSLVGKNF+K+YP+AYYKEKD Sbjct: 142 RREKSQTGGSSADIQGSSDPLEFVGMSLVGKNFKKYYPDAYYKEKD 187