BLASTX nr result
ID: Chrysanthemum22_contig00000130
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00000130 (2264 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009307587.1| ribosomal protein S18 (chloroplast) [Taraxac... 202 6e-58 ref|YP_007353788.1| ribosomal protein S18 (chloroplast) [Chrysan... 194 2e-55 ref|YP_007624817.1| chloroplast 30S ribosomal protein S18 (chlor... 192 1e-54 ref|YP_398351.1| ribosomal protein S18 [Lactuca sativa] >gi|9273... 190 1e-53 gb|AJE75187.1| ribosomal protein S18 (plastid) [Senecio integerr... 189 3e-53 ref|YP_588139.1| ribosomal protein S18 (chloroplast) [Helianthus... 189 3e-53 gb|ATC70017.1| ribosomal protein S18 (chloroplast) [Atractylodes... 188 4e-53 gb|AJE74731.1| ribosomal protein S18 (plastid) [Hymenopappus ten... 188 4e-53 ref|YP_009154807.1| ribosomal protein S18 (chloroplast) [Aster s... 188 4e-53 ref|YP_009271490.1| ribosomal protein S18 (chloroplast) [Eclipta... 188 5e-53 gb|AJE73211.1| ribosomal protein S18 (plastid) [Liatris squarrosa] 188 5e-53 ref|YP_009373853.1| ribosomal protein S18 (chloroplast) [Soliva ... 187 7e-53 ref|YP_004465209.1| ribosomal protein S18 [Jacobaea vulgaris] >g... 187 7e-53 gb|OTG26910.1| putative ribosomal protein S18 [Helianthus annuus] 187 1e-52 ref|YP_009139810.1| ribosomal protein S18 (chloroplast) [Cynara ... 187 1e-52 ref|YP_009376657.1| ribosomal protein S18 (chloroplast) [Hinterh... 186 2e-52 gb|AIW51866.1| ribosomal protein 18 (chloroplast) [Lasthenia bur... 186 2e-52 ref|YP_009040822.1| ribosomal protein S18 (chloroplast) (chlorop... 186 2e-52 ref|YP_009374447.1| ribosomal protein S18 (chloroplast) [Laestad... 186 3e-52 ref|YP_009371402.1| ribosomal protein S18 (chloroplast) [Diplost... 185 5e-52 >ref|YP_009307587.1| ribosomal protein S18 (chloroplast) [Taraxacum mongolicum] gb|AOR82334.1| ribosomal protein S18 (chloroplast) [Taraxacum mongolicum] Length = 113 Score = 202 bits (513), Expect = 6e-58 Identities = 111/131 (84%), Positives = 111/131 (84%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR*VYTFVT*IQIPIRTQMRI 234 LITIAIKQARILSLLPFLNNEKQ ERTE TTRTPSLRARK RI Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTPSLRARK------------------RI 102 Query: 233 DILLEKSKNPD 201 DILLEKSKNPD Sbjct: 103 DILLEKSKNPD 113 >ref|YP_007353788.1| ribosomal protein S18 (chloroplast) [Chrysanthemum x morifolium] ref|YP_007474751.1| ribosomal protein S18 (chloroplast) [Chrysanthemum indicum] ref|YP_009111759.1| chloroplast 30S ribosomal protein S18 (chloroplast) [Artemisia montana] ref|YP_009272099.1| ribosomal protein S18 (chloroplast) [Artemisia argyi] ref|YP_009307774.1| ribosomal protein S18 (chloroplast) [Artemisia gmelinii] ref|YP_009307862.1| ribosomal protein S18 (chloroplast) [Artemisia capillaris] ref|YP_009365263.1| chloroplast 30S ribosomal protein S18 (plastid) [Artemisia annua] gb|AEX99300.1| ribosomal protein S18 (chloroplast) [Chrysanthemum indicum] gb|AEX99536.1| ribosomal protein S18 (chloroplast) [Chrysanthemum indicum] gb|AFA45296.1| ribosomal protein S18 (chloroplast) [Chrysanthemum x morifolium] gb|AHJ61167.1| chloroplast 30S ribosomal protein S18 (chloroplast) [Artemisia montana] gb|AJB98650.1| ribosomal protein S18 (chloroplast) [Artemisia argyi] gb|AJE74959.1| ribosomal protein S18 (plastid) [Achillea millefolium] gb|ANS11279.1| ribosomal protein S18 (chloroplast) [Artemisia fukudo] gb|AOR82608.1| ribosomal protein S18 (chloroplast) [Artemisia gmelinii] gb|AOR82696.1| ribosomal protein S18 (chloroplast) [Artemisia capillaris] gb|ARJ60795.1| chloroplast 30S ribosomal protein S18 (plastid) [Artemisia annua] gb|ARU07832.1| ribosomal protein S18 (chloroplast) [Artemisia gmelinii] gb|ARU07920.1| ribosomal protein S18 (chloroplast) [Artemisia capillaris] gb|ATL16551.1| ribosomal protein S18 (chloroplast) [Artemisia princeps] gb|ATL16613.1| ribosomal protein S18 (chloroplast) [Artemisia argyrophylla] gb|ATL16675.1| ribosomal protein S18 (chloroplast) [Artemisia montana] gb|ATL16872.1| ribosomal protein S18 (chloroplast) [Chrysanthemum zawadskii var. latilobum] gb|ATL16935.1| ribosomal protein S18 (chloroplast) [Chrysanthemum zawadskii subsp. coreanum] gb|ATU84274.1| ribosomal protein S18 (chloroplast) [Artemisia annua] gb|AVI25931.1| ribosomal protein S18 (chloroplast) [Chrysanthemum boreale] Length = 101 Score = 194 bits (494), Expect = 2e-55 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 101 >ref|YP_007624817.1| chloroplast 30S ribosomal protein S18 (chloroplast) [Artemisia frigida] gb|AFP98843.1| chloroplast 30S ribosomal protein S18 (chloroplast) [Artemisia frigida] Length = 101 Score = 192 bits (488), Expect = 1e-54 Identities = 100/101 (99%), Positives = 100/101 (99%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQLER EPTTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQLERIEPTTRTPSLRARKR 101 >ref|YP_398351.1| ribosomal protein S18 [Lactuca sativa] ref|YP_009164424.1| ribosomal protein S18 (chloroplast) [Leontopodium leiolepis] ref|YP_009271403.1| ribosomal protein S18 (chloroplast) [Taraxacum officinale] ref|YP_009307500.1| ribosomal protein S18 (chloroplast) [Taraxacum platycarpum] ref|YP_009316567.1| ribosomal protein S18 (chloroplast) [Taraxacum obtusifrons] ref|YP_009316652.1| ribosomal protein S18 (chloroplast) [Taraxacum amplum] ref|YP_009320301.1| ribosomal protein S18 (chloroplast) [Pericallis hybrida] ref|YP_009327508.1| ribosomal protein S18 (chloroplast) [Taraxacum brevicorniculatum] ref|YP_009327590.1| ribosomal protein S18 (chloroplast) [Taraxacum kok-saghyz] ref|YP_009363810.1| ribosomal protein S18 (chloroplast) [Anaphalis sinica] ref|YP_009372082.1| ribosomal protein S18 (chloroplast) [Llerasia caucana] ref|YP_009458056.1| ribosomal protein S18 (chloroplast) [Dendrosenecio keniodendron] ref|YP_009458145.1| ribosomal protein S18 (chloroplast) [Dendrosenecio keniensis] ref|YP_009458233.1| ribosomal protein S18 (chloroplast) [Dendrosenecio battiscombei] sp|Q332V6.1|RR18_LACSA RecName: Full=30S ribosomal protein S18, chloroplastic dbj|BAE47616.1| chloroplast 30S ribosomal protein S18 (chloroplast) [Lactuca sativa] gb|ABD47255.1| ribosomal protein S18 (chloroplast) [Lactuca sativa] gb|AIZ76836.1| ribosomal protein S18 (chloroplast) [Leontopodium leiolepis] gb|AJE73439.1| ribosomal protein S18 (plastid) [Antennaria howellii] gb|AJE73819.1| ribosomal protein S18 (plastid) [Antennaria neglecta] gb|AJE73895.1| ribosomal protein S18 (plastid) [Vernonia baldwinii] gb|AJE74503.1| ribosomal protein S18 (plastid) [Lactuca ludoviciana] gb|AJE74655.1| ribosomal protein S18 (plastid) [Lygodesmia juncea] gb|AJE75111.1| ribosomal protein S18 (plastid) [Tragopogon dubius] gb|AKZ24359.1| ribosomal protein S18 (plastid) [Vernonia baldwinii] gb|ALE65949.1| ribosomal protein S18 (chloroplast) [Pericallis hybrida] gb|AMX21785.1| rps18 (mitochondrion) [Dendrosenecio brassiciformis] gb|ANS58016.1| ribosomal protein S18 (chloroplast) [Ligularia fischeri] gb|ANW47897.1| ribosomal protein S18 (chloroplast) [Taraxacum officinale] gb|AOR82247.1| ribosomal protein S18 (chloroplast) [Taraxacum platycarpum] gb|AOV93760.1| ribosomal protein S18 (chloroplast) [Taraxacum sp. RHS-2016] gb|AOV93845.1| ribosomal protein S18 (chloroplast) [Taraxacum obtusifrons] gb|AOV93929.1| ribosomal protein S18 (chloroplast) [Taraxacum amplum] gb|AOX48680.1| ribosomal protein S18 (chloroplast) [Anaphalis sinica] gb|APA33634.1| ribosomal protein S18 (chloroplast) [Taraxacum brevicorniculatum] gb|APA33716.1| ribosomal protein S18 (chloroplast) [Taraxacum kok-saghyz] gb|APA33798.1| ribosomal protein S18 (chloroplast) [Taraxacum officinale] gb|ARH07307.1| ribosomal protein S18 (chloroplast) [Llerasia caucana] gb|ATL57861.1| ribosomal protein S18 (chloroplast) [Dendrosenecio keniodendron] gb|ATL57950.1| ribosomal protein S18 (chloroplast) [Dendrosenecio keniensis] gb|ATL58039.1| ribosomal protein S18 (chloroplast) [Dendrosenecio battiscombei] Length = 101 Score = 190 bits (482), Expect = 1e-53 Identities = 99/101 (98%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTPSLRARKR 101 >gb|AJE75187.1| ribosomal protein S18 (plastid) [Senecio integerrimus] Length = 101 Score = 189 bits (479), Expect = 3e-53 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRTP+LRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTPNLRARKR 101 >ref|YP_588139.1| ribosomal protein S18 (chloroplast) [Helianthus annuus] ref|YP_001837382.1| ribosomal protein S18 [Guizotia abyssinica] ref|YP_003330980.1| ribosomal protein S18 [Parthenium argentatum] ref|YP_004564394.1| ribosomal protein S18 (chloroplast) [Ageratina adenophora] ref|YP_008964379.1| ribosomal protein S18 [Helianthus divaricatus] ref|YP_008964464.1| ribosomal protein S18 [Helianthus decapetalus] ref|YP_008964719.1| ribosomal protein S18 [Helianthus strumosus] ref|YP_008964804.1| ribosomal protein S18 [Helianthus maximiliani] ref|YP_008964209.1| ribosomal protein S18 [Helianthus giganteus] ref|YP_008964294.1| ribosomal protein S18 [Helianthus grosseserratus] ref|YP_008964549.1| ribosomal protein S18 [Helianthus hirsutus] ref|YP_008964634.1| ribosomal protein S18 [Helianthus tuberosus] ref|YP_009020765.1| ribosomal protein S18 (chloroplast) [Praxelis clematidea] ref|YP_009252971.1| ribosomal protein S18 (chloroplast) [Helianthus debilis] ref|YP_009255897.1| ribosomal protein S18 (chloroplast) [Helianthus argophyllus] ref|YP_009317322.1| ribosomal protein S18 (chloroplast) [Mikania micrantha] ref|YP_009318018.1| ribosomal protein S18 (chloroplast) [Galinsoga quadriradiata] ref|YP_009428013.1| ribosomal protein S18 (chloroplast) [Ambrosia artemisiifolia] ref|YP_009447388.1| ribosomal protein S18 (chloroplast) [Achyrachaena mollis] ref|YP_009456331.1| ribosomal protein S18 (chloroplast) [Ambrosia trifida] sp|Q1KXT7.1|RR18_HELAN RecName: Full=30S ribosomal protein S18, chloroplastic sp|B2LML5.1|RR18_GUIAB RecName: Full=30S ribosomal protein S18, chloroplastic gb|ABD47168.1| ribosomal protein S18 (chloroplast) [Helianthus annuus] gb|ACB86549.1| ribosomal protein S18 (chloroplast) [Guizotia abyssinica] gb|ACZ52729.1| ribosomal protein S18 (chloroplast) [Parthenium argentatum] gb|AEG64578.1| ribosomal protein S18 (chloroplast) [Ageratina adenophora] gb|AHB14479.1| ribosomal protein S18 (plastid) [Helianthus giganteus] gb|AHB14564.1| ribosomal protein S18 (plastid) [Helianthus giganteus] gb|AHB14649.1| ribosomal protein S18 (plastid) [Helianthus giganteus] gb|AHB14734.1| ribosomal protein S18 (plastid) [Helianthus giganteus] gb|AHB14819.1| ribosomal protein S18 (plastid) [Helianthus grosseserratus] gb|AHB14904.1| ribosomal protein S18 (plastid) [Helianthus grosseserratus] gb|AHB14989.1| ribosomal protein S18 (plastid) [Helianthus divaricatus] gb|AHB15074.1| ribosomal protein S18 (plastid) [Helianthus divaricatus] gb|AHB15159.1| ribosomal protein S18 (plastid) [Helianthus divaricatus] gb|AHB15244.1| ribosomal protein S18 (plastid) [Helianthus divaricatus] gb|AHB15329.1| ribosomal protein S18 (plastid) [Helianthus decapetalus] gb|AHB15414.1| ribosomal protein S18 (plastid) [Helianthus decapetalus] gb|AHB15499.1| ribosomal protein S18 (plastid) [Helianthus decapetalus] gb|AHB15584.1| ribosomal protein S18 (plastid) [Helianthus hirsutus] gb|AHB15669.1| ribosomal protein S18 (plastid) [Helianthus hirsutus] gb|AHB15754.1| ribosomal protein S18 (plastid) [Helianthus tuberosus] gb|AHB15839.1| ribosomal protein S18 (plastid) [Helianthus tuberosus] gb|AHB15924.1| ribosomal protein S18 (plastid) [Helianthus tuberosus] gb|AHB16009.1| ribosomal protein S18 (plastid) [Helianthus divaricatus] gb|AHB16094.1| ribosomal protein S18 (plastid) [Helianthus giganteus] gb|AHB16179.1| ribosomal protein S18 (plastid) [Helianthus giganteus] gb|AHB16264.1| ribosomal protein S18 (plastid) [Helianthus grosseserratus] gb|AHB16349.1| ribosomal protein S18 (plastid) [Helianthus grosseserratus] gb|AHB16434.1| ribosomal protein S18 (plastid) [Helianthus grosseserratus] gb|AHB16519.1| ribosomal protein S18 (plastid) [Helianthus grosseserratus] gb|AHB16604.1| ribosomal protein S18 (plastid) [Helianthus decapetalus] gb|AHB16689.1| ribosomal protein S18 (plastid) [Helianthus decapetalus] gb|AHB16774.1| ribosomal protein S18 (plastid) [Helianthus decapetalus] gb|AHB16859.1| ribosomal protein S18 (plastid) [Helianthus hirsutus] gb|AHB16944.1| ribosomal protein S18 (plastid) [Helianthus hirsutus] gb|AHB17029.1| ribosomal protein S18 (plastid) [Helianthus strumosus] gb|AHB17114.1| ribosomal protein S18 (plastid) [Helianthus tuberosus] gb|AHB17199.1| ribosomal protein S18 (plastid) [Helianthus tuberosus] gb|AHB17284.1| ribosomal protein S18 (plastid) [Helianthus tuberosus] gb|AHB17369.1| ribosomal protein S18 (plastid) [Helianthus maximiliani] gb|AHB17454.1| ribosomal protein S18 (plastid) [Helianthus maximiliani] gb|AHB17539.1| ribosomal protein S18 (plastid) [Helianthus maximiliani] gb|AHB17624.1| ribosomal protein S18 (plastid) [Helianthus maximiliani] gb|AHM02425.1| ribosomal protein S18 (chloroplast) [Praxelis clematidea] gb|AJE73287.1| ribosomal protein S18 (plastid) [Bidens aristosa] gb|AJE73971.1| ribosomal protein S18 (plastid) [Helenium flexuosum] gb|AJE74275.1| ribosomal protein S18 (plastid) [Helianthus petiolaris] gb|AJE74351.1| ribosomal protein S18 (plastid) [Thelesperma filifolium] gb|AJE74427.1| ribosomal protein S18 (plastid) [Helianthus mollis] gb|AJE74579.1| ribosomal protein S18 (plastid) [Ratibida columnifera] gb|AKZ24360.1| ribosomal protein S18 (plastid) [Helianthus pauciflorus subsp. subrhomboideus] gb|AKZ24361.1| ribosomal protein S18 (plastid) [Helianthus tuberosus] gb|AKZ24362.1| ribosomal protein S18 (plastid) [Heliopsis helianthoides var. occidentalis] gb|AKZ24363.1| ribosomal protein S18 (plastid) [Silphium integrifolium] gb|AKZ24364.1| ribosomal protein S18 (plastid) [Rudbeckia hirta var. pulcherrima] gb|AMQ33959.1| ribosomal protein S18 (chloroplast) [Helianthus petiolaris subsp. fallax] gb|AMX21493.1| ribosomal protein S18 (chloroplast) [Helianthus praecox] gb|AMX22366.1| ribosomal protein S18 (chloroplast) [Helianthus petiolaris] gb|ANA91230.1| ribosomal protein S18 (chloroplast) [Helianthus debilis] gb|ANB79016.1| ribosomal protein S18 (chloroplast) [Helianthus annuus subsp. texanus] gb|ANF03687.1| ribosomal protein S18 (chloroplast) [Helianthus argophyllus] gb|ANF03923.1| ribosomal protein S18 (plastid) [Helianthus annuus] gb|AOX22883.1| ribosomal protein S18 (chloroplast) [Mikania micrantha] gb|AOY41671.1| ribosomal protein S18 (chloroplast) [Galinsoga quadriradiata] gb|OTF84766.1| putative ribosomal protein S18 (plastid) [Helianthus annuus] gb|OTG07132.1| putative ribosomal protein S18 [Helianthus annuus] gb|OTG10077.1| putative ribosomal protein S18 [Helianthus annuus] gb|OTG10136.1| putative ribosomal protein S18 [Helianthus annuus] gb|OTG10590.1| putative ribosomal protein S18 [Helianthus annuus] gb|OTG13221.1| putative ribosomal protein S18 [Helianthus annuus] gb|OTG34069.1| putative ribosomal protein S18 [Helianthus annuus] gb|OTG34352.1| putative ribosomal protein S18 [Helianthus annuus] gb|OTG36182.1| putative ribosomal protein S18 [Helianthus annuus] gb|OTG37578.1| putative ribosomal protein S18 [Helianthus annuus] gb|ASU96441.1| ribosomal protein S18 (chloroplast) [Lasthenia californica] gb|ASV47889.1| ribosomal protein S18 (chloroplast) [Ambrosia artemisiifolia] gb|ATY69673.1| ribosomal protein S18 (chloroplast) [Achyrachaena mollis] gb|AUJ22617.1| ribosomal protein S18 (chloroplast) [Ambrosia artemisiifolia] gb|AUJ22704.1| ribosomal protein S18 (chloroplast) [Ambrosia trifida] gb|AVN90093.1| ribosomal protein S18 (chloroplast) [Helianthus tuberosus] Length = 101 Score = 189 bits (479), Expect = 3e-53 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFR+RLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRKRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTPSLRARKR 101 >gb|ATC70017.1| ribosomal protein S18 (chloroplast) [Atractylodes lancea] gb|ATL16495.1| ribosomal protein S18 (chloroplast) [Atractylodes macrocephala] Length = 101 Score = 188 bits (478), Expect = 4e-53 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKN+SLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNISLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTPSLRARKR 101 >gb|AJE74731.1| ribosomal protein S18 (plastid) [Hymenopappus tenuifolius] gb|OTG26989.1| putative 30S ribosomal protein S18 protein [Helianthus annuus] Length = 101 Score = 188 bits (478), Expect = 4e-53 Identities = 97/101 (96%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFR+RLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRKRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LIT+AIKQARILSLLPFLNNEKQ ERTE TTRTPSLRARKR Sbjct: 61 LITVAIKQARILSLLPFLNNEKQFERTESTTRTPSLRARKR 101 >ref|YP_009154807.1| ribosomal protein S18 (chloroplast) [Aster spathulifolius] ref|YP_009371317.1| ribosomal protein S18 (chloroplast) [Diplostephium pulchrum] ref|YP_009372252.1| ribosomal protein S18 (chloroplast) [Diplostephium huertasii] ref|YP_009371657.1| ribosomal protein S18 (chloroplast) [Diplostephium juniperinum] ref|YP_009372507.1| ribosomal protein S18 (chloroplast) [Diplostephium obtusum] ref|YP_009371742.1| ribosomal protein S18 (chloroplast) [Diplostephium oxapampanum] ref|YP_009371487.1| ribosomal protein S18 (chloroplast) [Diplostephium lechleri] ref|YP_009371912.1| ribosomal protein S18 (chloroplast) [Diplostephium violaceum] ref|YP_009371997.1| ribosomal protein S18 (chloroplast) [Diplostephium oblongifolium] ref|YP_009371572.1| ribosomal protein S18 (chloroplast) [Lagenophora cuchumatanica] ref|YP_009371827.1| ribosomal protein S18 (chloroplast) [Diplostephium rhododendroides] ref|YP_009372167.1| ribosomal protein S18 (chloroplast) [Diplostephium juajibioyi] ref|YP_009372337.1| ribosomal protein S18 (chloroplast) [Diplostephium spinulosum] ref|YP_009372422.1| ribosomal protein S18 (chloroplast) [Diplostephium meyenii] ref|YP_009372592.1| ribosomal protein S18 (chloroplast) [Diplostephium tachirense] ref|YP_009372677.1| ribosomal protein S18 (chloroplast) [Diplostephium serratifolium] ref|YP_009372762.1| ribosomal protein S18 (chloroplast) [Diplostephium mutiscuanum] ref|YP_009372847.1| ribosomal protein S18 (chloroplast) [Diplostephium sagasteguii] ref|YP_009372932.1| ribosomal protein S18 (chloroplast) [Diplostephium jenesanum] ref|YP_009373101.1| ribosomal protein S18 (chloroplast) [Diplostephium hippophae] ref|YP_009373186.1| ribosomal protein S18 (chloroplast) [Diplostephium hartwegii] ref|YP_009373513.1| ribosomal protein S18 (chloroplast) [Diplostephium alveolatum] ref|YP_009373598.1| ribosomal protein S18 (chloroplast) [Archibaccharis asperifolia] ref|YP_009373683.1| ribosomal protein S18 (chloroplast) [Oritrophium peruvianum] ref|YP_009373768.1| ribosomal protein S18 (chloroplast) [Diplostephium cinerascens] ref|YP_009374192.1| ribosomal protein S18 (chloroplast) [Heterothalamus alienus] ref|YP_009374277.1| ribosomal protein S18 (chloroplast) [Diplostephium callilepis] ref|YP_009374362.1| ribosomal protein S18 (chloroplast) [Diplostephium floribundum] ref|YP_009374532.1| ribosomal protein S18 (chloroplast) [Diplostephium rhomboidale] ref|YP_009374787.1| ribosomal protein S18 (chloroplast) [Diplostephium gynoxyoides] ref|YP_009376487.1| ribosomal protein S18 (chloroplast) [Diplostephium azureum] ref|YP_009376572.1| ribosomal protein S18 (chloroplast) [Diplostephium foliosissimum] ref|YP_009376827.1| ribosomal protein S18 (chloroplast) [Diplostephium cayambense] ref|YP_009376997.1| ribosomal protein S18 (chloroplast) [Floscaldasia hypsophila] ref|YP_009377167.1| ribosomal protein S18 (chloroplast) [Parastrephia quadrangularis] ref|YP_009377507.1| ribosomal protein S18 (chloroplast) [Diplostephium jaramilloi] ref|YP_009377677.1| ribosomal protein S18 (chloroplast) [Diplostephium heterophyllum] ref|YP_009377762.1| ribosomal protein S18 (chloroplast) [Diplostephium camargoanum] ref|YP_009378272.1| ribosomal protein S18 (chloroplast) [Diplostephium ochraceum] ref|YP_009373938.1| ribosomal protein S18 (chloroplast) [Baccharis genistelloides] ref|YP_009374022.1| ribosomal protein S18 (chloroplast) [Diplostephium barclayanum] ref|YP_009374617.1| ribosomal protein S18 (chloroplast) [Diplostephium tenuifolium] ref|YP_009374702.1| ribosomal protein S18 (chloroplast) [Diplostephium colombianum] ref|YP_009374872.1| ribosomal protein S18 (chloroplast) [Diplostephium revolutum] ref|YP_009374957.1| ribosomal protein S18 (chloroplast) [Exostigma notobellidiastrum] ref|YP_009375042.1| ribosomal protein S18 (chloroplast) [Diplostephium rupestre] ref|YP_009375212.1| ribosomal protein S18 (chloroplast) [Diplostephium gnidioides] ref|YP_009375297.1| ribosomal protein S18 (chloroplast) [Baccharis tricuneata] ref|YP_009375382.1| ribosomal protein S18 (chloroplast) [Diplostephium cinereum] ref|YP_009375467.1| ribosomal protein S18 (chloroplast) [Diplostephium ericoides] ref|YP_009375552.1| ribosomal protein S18 (chloroplast) [Diplostephium haenkei] ref|YP_009375722.1| ribosomal protein S18 (chloroplast) [Diplostephium phylicoides] ref|YP_009375807.1| ribosomal protein S18 (chloroplast) [Diplostephium eriophorum] ref|YP_009375892.1| ribosomal protein S18 (chloroplast) [Diplostephium glutinosum] ref|YP_009375977.1| ribosomal protein S18 (chloroplast) [Diplostephium antioquense] ref|YP_009376062.1| ribosomal protein S18 (chloroplast) [Laennecia sophiifolia] ref|YP_009376147.1| ribosomal protein S18 (chloroplast) [Diplostephium lacunosum] ref|YP_009376232.1| ribosomal protein S18 (chloroplast) [Diplostephium costaricense] ref|YP_009376317.1| ribosomal protein S18 (chloroplast) [Diplostephium espinosae] ref|YP_009376402.1| ribosomal protein S18 (chloroplast) [Diplostephium crypteriophyllum] ref|YP_009376742.1| ribosomal protein S18 (chloroplast) [Diplostephium romeroi] ref|YP_009376912.1| ribosomal protein S18 (chloroplast) [Diplostephium venezuelense] ref|YP_009377082.1| ribosomal protein S18 (chloroplast) [Westoniella kohkemperi] ref|YP_009377252.1| ribosomal protein S18 (chloroplast) [Diplostephium empetrifolium] ref|YP_009377337.1| ribosomal protein S18 (chloroplast) [Diplostephium schultzii] ref|YP_009377422.1| ribosomal protein S18 (chloroplast) [Diplostephium frontinense] ref|YP_009377592.1| ribosomal protein S18 (chloroplast) [Diplostephium inesianum] ref|YP_009377847.1| ribosomal protein S18 (chloroplast) [Aztecaster matudae] ref|YP_009377932.1| ribosomal protein S18 (chloroplast) [Diplostephium coriaceum] ref|YP_009378017.1| ribosomal protein S18 (chloroplast) [Diplostephium rosmarinifolium] ref|YP_009378102.1| ribosomal protein S18 (chloroplast) [Diplostephium goodspeedii] ref|YP_009378187.1| ribosomal protein S18 (chloroplast) [Diplostephium apiculatum] ref|YP_009383558.1| ribosomal protein S18 (chloroplast) [Aster altaicus] ref|YP_009428491.1| ribosomal protein S18 (chloroplast) [Conyza bonariensis] gb|AGX29629.1| ribosomal protein S18 (chloroplast) [Aster spathulifolius] gb|AJE73059.1| ribosomal protein S18 (plastid) [Xanthisma spinulosum] gb|AJE73135.1| ribosomal protein S18 (plastid) [Gutierrezia sarothrae] gb|AJE73363.1| ribosomal protein S18 (plastid) [Erigeron strigosus] gb|AJE73591.1| ribosomal protein S18 (plastid) [Solidago canadensis var. scabra] gb|AJE73667.1| ribosomal protein S18 (plastid) [Erigeron philadelphicus] gb|AJE73743.1| ribosomal protein S18 (plastid) [Heterotheca stenophylla] gb|AJE74047.1| ribosomal protein S18 (plastid) [Heterotheca villosa] gb|AJE74883.1| ribosomal protein S18 (plastid) [Solidago gigantea] gb|AJE75035.1| ribosomal protein S18 (plastid) [Erigeron bellidiastrum] gb|AKZ24365.1| ribosomal protein S18 (plastid) [Grindelia squarrosa var. squarrosa] gb|AKZ24366.1| ribosomal protein S18 (plastid) [Solidago missouriensis] gb|AQX33568.1| ribosomal protein S18 (chloroplast) [Pityopsis falcata] gb|ARH02888.1| ribosomal protein S18 (chloroplast) [Diplostephium alveolatum] gb|ARH02973.1| ribosomal protein S18 (chloroplast) [Diplostephium pulchrum] gb|ARH03058.1| ribosomal protein S18 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH03143.1| ribosomal protein S18 (chloroplast) [Archibaccharis asperifolia] gb|ARH03313.1| ribosomal protein S18 (chloroplast) [Oritrophium peruvianum] gb|ARH03398.1| ribosomal protein S18 (chloroplast) [Diplostephium cinerascens] gb|ARH03568.1| ribosomal protein S18 (chloroplast) [Baccharis genistelloides] gb|ARH03652.1| ribosomal protein S18 (chloroplast) [Diplostephium barclayanum] gb|ARH03822.1| ribosomal protein S18 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH03907.1| ribosomal protein S18 (chloroplast) [Diplostephium lechleri] gb|ARH03992.1| ribosomal protein S18 (chloroplast) [Heterothalamus alienus] gb|ARH04077.1| ribosomal protein S18 (chloroplast) [Diplostephium callilepis] gb|ARH04162.1| ribosomal protein S18 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH04247.1| ribosomal protein S18 (chloroplast) [Diplostephium floribundum] gb|ARH04417.1| ribosomal protein S18 (chloroplast) [Diplostephium rhomboidale] gb|ARH04502.1| ribosomal protein S18 (chloroplast) [Diplostephium tenuifolium] gb|ARH04587.1| ribosomal protein S18 (chloroplast) [Diplostephium colombianum] gb|ARH04672.1| ribosomal protein S18 (chloroplast) [Diplostephium gynoxyoides] gb|ARH04757.1| ribosomal protein S18 (chloroplast) [Diplostephium revolutum] gb|ARH04842.1| ribosomal protein S18 (chloroplast) [Lagenophora cuchumatanica] gb|ARH04927.1| ribosomal protein S18 (chloroplast) [Diplostephium hartwegii] gb|ARH05012.1| ribosomal protein S18 (chloroplast) [Exostigma notobellidiastrum] gb|ARH05097.1| ribosomal protein S18 (chloroplast) [Diplostephium rupestre] gb|ARH05182.1| ribosomal protein S18 (chloroplast) [Diplostephium juniperinum] gb|ARH05267.1| ribosomal protein S18 (chloroplast) [Diplostephium oxapampanum] gb|ARH05352.1| ribosomal protein S18 (chloroplast) [Diplostephium rhododendroides] gb|ARH05522.1| ribosomal protein S18 (chloroplast) [Diplostephium gnidioides] gb|ARH05607.1| ribosomal protein S18 (chloroplast) [Baccharis tricuneata] gb|ARH05692.1| ribosomal protein S18 (chloroplast) [Diplostephium cinereum] gb|ARH05777.1| ribosomal protein S18 (chloroplast) [Diplostephium rhomboidale] gb|ARH05862.1| ribosomal protein S18 (chloroplast) [Diplostephium violaceum] gb|ARH05947.1| ribosomal protein S18 (chloroplast) [Diplostephium ericoides] gb|ARH06032.1| ribosomal protein S18 (chloroplast) [Diplostephium haenkei] gb|ARH06202.1| ribosomal protein S18 (chloroplast) [Diplostephium phylicoides] gb|ARH06287.1| ribosomal protein S18 (chloroplast) [Diplostephium eriophorum] gb|ARH06372.1| ribosomal protein S18 (chloroplast) [Diplostephium glutinosum] gb|ARH06457.1| ribosomal protein S18 (chloroplast) [Diplostephium antioquense] gb|ARH06542.1| ribosomal protein S18 (chloroplast) [Laennecia sophiifolia] gb|ARH06627.1| ribosomal protein S18 (chloroplast) [Diplostephium lacunosum] gb|ARH06712.1| ribosomal protein S18 (chloroplast) [Diplostephium costaricense] gb|ARH06797.1| ribosomal protein S18 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH06882.1| ribosomal protein S18 (chloroplast) [Diplostephium espinosae] gb|ARH06967.1| ribosomal protein S18 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH07052.1| ribosomal protein S18 (chloroplast) [Diplostephium crypteriophyllum] gb|ARH07137.1| ribosomal protein S18 (chloroplast) [Diplostephium oblongifolium] gb|ARH07222.1| ribosomal protein S18 (chloroplast) [Diplostephium azureum] gb|ARH07392.1| ribosomal protein S18 (chloroplast) [Diplostephium foliosissimum] gb|ARH07562.1| ribosomal protein S18 (chloroplast) [Diplostephium romeroi] gb|ARH07647.1| ribosomal protein S18 (chloroplast) [Diplostephium cayambense] gb|ARH07732.1| ribosomal protein S18 (chloroplast) [Diplostephium juajibioyi] gb|ARH07817.1| ribosomal protein S18 (chloroplast) [Diplostephium venezuelense] gb|ARH07902.1| ribosomal protein S18 (chloroplast) [Diplostephium huertasii] gb|ARH07987.1| ribosomal protein S18 (chloroplast) [Floscaldasia hypsophila] gb|ARH08072.1| ribosomal protein S18 (chloroplast) [Diplostephium spinulosum] gb|ARH08157.1| ribosomal protein S18 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH08242.1| ribosomal protein S18 (chloroplast) [Diplostephium meyenii] gb|ARH08327.1| ribosomal protein S18 (chloroplast) [Diplostephium obtusum] gb|ARH08412.1| ribosomal protein S18 (chloroplast) [Westoniella kohkemperi] gb|ARH08497.1| ribosomal protein S18 (chloroplast) [Diplostephium tachirense] gb|ARH08582.1| ribosomal protein S18 (chloroplast) [Parastrephia quadrangularis] gb|ARH08667.1| ribosomal protein S18 (chloroplast) [Diplostephium serratifolium] gb|ARH08752.1| ribosomal protein S18 (chloroplast) [Diplostephium empetrifolium] gb|ARH08837.1| ribosomal protein S18 (chloroplast) [Diplostephium schultzii] gb|ARH08922.1| ribosomal protein S18 (chloroplast) [Diplostephium frontinense] gb|ARH09007.1| ribosomal protein S18 (chloroplast) [Diplostephium jaramilloi] gb|ARH09092.1| ribosomal protein S18 (chloroplast) [Diplostephium mutiscuanum] gb|ARH09177.1| ribosomal protein S18 (chloroplast) [Diplostephium inesianum] gb|ARH09262.1| ribosomal protein S18 (chloroplast) [Diplostephium heterophyllum] gb|ARH09347.1| ribosomal protein S18 (chloroplast) [Diplostephium sagasteguii] gb|ARH09432.1| ribosomal protein S18 (chloroplast) [Diplostephium camargoanum] gb|ARH09517.1| ribosomal protein S18 (chloroplast) [Diplostephium jenesanum] gb|ARH09601.1| ribosomal protein S18 (chloroplast) [Aztecaster matudae] gb|ARH09686.1| ribosomal protein S18 (chloroplast) [Diplostephium schultzii] gb|ARH09771.1| ribosomal protein S18 (chloroplast) [Diplostephium coriaceum] gb|ARH09856.1| ribosomal protein S18 (chloroplast) [Diplostephium sp. CAJ2] gb|ARH09941.1| ribosomal protein S18 (chloroplast) [Diplostephium rosmarinifolium] gb|ARH10026.1| ribosomal protein S18 (chloroplast) [Diplostephium goodspeedii] gb|ARH10196.1| ribosomal protein S18 (chloroplast) [Diplostephium pulchrum] gb|ARH10281.1| ribosomal protein S18 (chloroplast) [Diplostephium apiculatum] gb|ARH10366.1| ribosomal protein S18 (chloroplast) [Diplostephium hippophae] gb|ARH10451.1| ribosomal protein S18 (chloroplast) [Diplostephium ochraceum] gb|ARH10536.1| ribosomal protein S18 (chloroplast) [Diplostephium sp. CAJ2] gb|ARO73698.1| ribosomal protein S18 (chloroplast) [Conyza bonariensis] gb|ARR27855.1| ribosomal protein S18 (chloroplast) [Aster altaicus] gb|ASW20552.1| ribosomal protein S18 (chloroplast) [Conyza bonariensis] Length = 101 Score = 188 bits (478), Expect = 4e-53 Identities = 98/101 (97%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 M+KSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MEKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTPSLRARKR 101 >ref|YP_009271490.1| ribosomal protein S18 (chloroplast) [Eclipta prostrata] ref|YP_009354908.1| ribosomal protein S18 (plastid) [Echinacea angustifolia] ref|YP_009354653.1| ribosomal protein S18 (plastid) [Echinacea pallida] ref|YP_009354738.1| ribosomal protein S18 (plastid) [Echinacea laevigata] ref|YP_009354823.1| ribosomal protein S18 (plastid) [Echinacea atrorubens] ref|YP_009354993.1| ribosomal protein S18 (plastid) [Echinacea speciosa] ref|YP_009355078.1| ribosomal protein S18 (plastid) [Echinacea tennesseensis] ref|YP_009355163.1| ribosomal protein S18 (plastid) [Echinacea purpurea] ref|YP_009355248.1| ribosomal protein S18 (plastid) [Echinacea sanguinea] ref|YP_009354568.1| ribosomal protein S18 (plastid) [Echinacea paradoxa] gb|AJE74199.1| ribosomal protein S18 (plastid) [Echinacea angustifolia] gb|ANW47984.1| ribosomal protein S18 (chloroplast) [Eclipta prostrata] gb|ARB02751.1| ribosomal protein S18 (plastid) [Echinacea paradoxa] gb|ARB02836.1| ribosomal protein S18 (plastid) [Echinacea pallida] gb|ARB02921.1| ribosomal protein S18 (plastid) [Echinacea laevigata] gb|ARB03006.1| ribosomal protein S18 (plastid) [Echinacea atrorubens] gb|ARB03091.1| ribosomal protein S18 (plastid) [Echinacea angustifolia] gb|ARB03176.1| ribosomal protein S18 (plastid) [Echinacea speciosa] gb|ARB03261.1| ribosomal protein S18 (plastid) [Echinacea tennesseensis] gb|ARB03346.1| ribosomal protein S18 (plastid) [Echinacea purpurea] gb|ARB03431.1| ribosomal protein S18 (plastid) [Echinacea sanguinea] Length = 101 Score = 188 bits (477), Expect = 5e-53 Identities = 97/101 (96%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFR+RLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRKRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRTPS+RARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTPSIRARKR 101 >gb|AJE73211.1| ribosomal protein S18 (plastid) [Liatris squarrosa] Length = 101 Score = 188 bits (477), Expect = 5e-53 Identities = 97/101 (96%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFR+RLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRKRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPF+NNEKQ ERTE TTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFINNEKQFERTESTTRTPSLRARKR 101 >ref|YP_009373853.1| ribosomal protein S18 (chloroplast) [Soliva sessilis] gb|ARH03483.1| ribosomal protein S18 (chloroplast) [Soliva sessilis] Length = 101 Score = 187 bits (476), Expect = 7e-53 Identities = 98/101 (97%), Positives = 98/101 (97%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEK ERTE TTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKPFERTESTTRTPSLRARKR 101 >ref|YP_004465209.1| ribosomal protein S18 [Jacobaea vulgaris] gb|ADO15432.1| ribosomal protein S18 (chloroplast) [Jacobaea vulgaris] Length = 101 Score = 187 bits (476), Expect = 7e-53 Identities = 97/101 (96%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNN+KQ ERTE TTRTP+LRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNDKQFERTESTTRTPNLRARKR 101 >gb|OTG26910.1| putative ribosomal protein S18 [Helianthus annuus] Length = 101 Score = 187 bits (475), Expect = 1e-52 Identities = 97/101 (96%), Positives = 99/101 (98%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFR+RLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQ+ Sbjct: 1 MDKSKRTFLKSKRSFRKRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQQ 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTPSLRARKR 101 >ref|YP_009139810.1| ribosomal protein S18 (chloroplast) [Cynara humilis] ref|YP_009169516.1| ribosomal protein S18 (chloroplast) [Cynara baetica] ref|YP_009169603.1| ribosomal protein S18 (chloroplast) [Cynara cornigera] ref|YP_009170285.1| ribosomal protein S18 (chloroplast) [Silybum marianum] ref|YP_009271927.1| ribosomal protein S18 (chloroplast) [Carthamus tinctorius] ref|YP_009446373.1| ribosomal protein S18 (chloroplast) [Saussurea polylepis] ref|YP_009450404.1| ribosomal protein S18 (chloroplast) [Saussurea chabyoungsanica] ref|YP_009460533.1| ribosomal protein S18 (plastid) [Cirsium arvense] ref|YP_009460621.1| ribosomal protein S18 (plastid) [Cirsium eriophorum] ref|YP_009460709.1| ribosomal protein S18 (plastid) [Cirsium vulgare] gb|AIU98566.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. scolymus] gb|AIY72409.1| ribosomal protein S18 (chloroplast) [Carthamus tinctorius] gb|AJE73515.1| ribosomal protein S18 (plastid) [Cirsium undulatum] gb|AJE74123.1| ribosomal protein S18 (plastid) [Cirsium altissimum] gb|AJE74807.1| ribosomal protein S18 (plastid) [Cirsium canescens] gb|AKG49818.1| ribosomal protein S18 (chloroplast) [Cynara humilis] gb|AKH02229.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. scolymus] gb|AKJ77474.1| ribosomal protein S18 (chloroplast) [Carthamus tinctorius] gb|AKQ49293.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. altilis] gb|AKQ49380.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. altilis] gb|AKQ49467.1| ribosomal protein S18 (chloroplast) [Cynara baetica] gb|AKQ49554.1| ribosomal protein S18 (chloroplast) [Cynara cornigera] gb|AKQ49641.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49728.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49815.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49902.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ49989.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ50076.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. scolymus] gb|AKQ50163.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50250.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50337.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50424.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50511.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50598.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50685.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50772.1| ribosomal protein S18 (chloroplast) [Cynara cardunculus var. sylvestris] gb|AKQ50859.1| ribosomal protein S18 (chloroplast) [Cynara syriaca] gb|AKZ24358.1| ribosomal protein S18 (plastid) [Carduus nutans] gb|ALE29295.1| ribosomal protein S18 (chloroplast) [Silybum marianum] gb|APD83360.1| ribosomal protein S18 (chloroplast) [Carthamus tinctorius] gb|APZ75497.1| ribosomal protein S18 (chloroplast) [Saussurea chabyoungsanica] gb|ATL16741.1| ribosomal protein S18 (chloroplast) [Cirsium japonicum var. maackii] gb|ATL16806.1| ribosomal protein S18 (chloroplast) [Cirsium japonicum var. spinosissimum] gb|ATY40811.1| ribosomal protein S18 (chloroplast) [Saussurea polylepis] gb|AUT81834.1| ribosomal protein S18 (plastid) [Cirsium arvense] gb|AUT81922.1| ribosomal protein S18 (plastid) [Cirsium eriophorum] gb|AUT82010.1| ribosomal protein S18 (plastid) [Cirsium vulgare] Length = 101 Score = 187 bits (474), Expect = 1e-52 Identities = 98/101 (97%), Positives = 98/101 (97%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRT SLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTSSLRARKR 101 >ref|YP_009376657.1| ribosomal protein S18 (chloroplast) [Hinterhubera ericoides] ref|YP_009375127.1| ribosomal protein S18 (chloroplast) [Blakiella bartsiifolia] gb|ARH05437.1| ribosomal protein S18 (chloroplast) [Blakiella bartsiifolia] gb|ARH07477.1| ribosomal protein S18 (chloroplast) [Hinterhubera ericoides] Length = 101 Score = 186 bits (473), Expect = 2e-52 Identities = 97/101 (96%), Positives = 98/101 (97%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 M+KSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MEKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTR PSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRNPSLRARKR 101 >gb|AIW51866.1| ribosomal protein 18 (chloroplast) [Lasthenia burkei] Length = 101 Score = 186 bits (473), Expect = 2e-52 Identities = 97/101 (96%), Positives = 98/101 (97%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFR+RLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRKRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESPTRTPSLRARKR 101 >ref|YP_009040822.1| ribosomal protein S18 (chloroplast) (chloroplast) [Centaurea diffusa] gb|AIB03776.1| ribosomal protein S18 (chloroplast) (chloroplast) [Centaurea diffusa] Length = 101 Score = 186 bits (473), Expect = 2e-52 Identities = 97/101 (96%), Positives = 98/101 (97%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LIT+AIKQARILSLLPFLNNEKQ ERTE TTRT SLRARKR Sbjct: 61 LITVAIKQARILSLLPFLNNEKQFERTESTTRTSSLRARKR 101 >ref|YP_009374447.1| ribosomal protein S18 (chloroplast) [Laestadia muscicola] gb|ARH04332.1| ribosomal protein S18 (chloroplast) [Laestadia muscicola] Length = 101 Score = 186 bits (472), Expect = 3e-52 Identities = 97/101 (96%), Positives = 98/101 (97%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 M+KSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MEKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TRTPSLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESITRTPSLRARKR 101 >ref|YP_009371402.1| ribosomal protein S18 (chloroplast) [Diplostephium jelskii] ref|YP_009373016.1| ribosomal protein S18 (chloroplast) [Diplostephium oblanceolatum] ref|YP_009374107.1| ribosomal protein S18 (chloroplast) [Diplostephium glandulosum] ref|YP_009375637.1| ribosomal protein S18 (chloroplast) [Diplostephium cajamarquillense] gb|ARH03228.1| ribosomal protein S18 (chloroplast) [Diplostephium jelskii] gb|ARH03737.1| ribosomal protein S18 (chloroplast) [Diplostephium glandulosum] gb|ARH06117.1| ribosomal protein S18 (chloroplast) [Diplostephium cajamarquillense] gb|ARH10111.1| ribosomal protein S18 (chloroplast) [Diplostephium oblanceolatum] Length = 101 Score = 185 bits (470), Expect = 5e-52 Identities = 97/101 (96%), Positives = 98/101 (97%) Frame = -1 Query: 593 MDKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 414 M+KSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR Sbjct: 1 MEKSKRTFLKSKRSFRRRLPPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQR 60 Query: 413 LITIAIKQARILSLLPFLNNEKQLERTEPTTRTPSLRARKR 291 LITIAIKQARILSLLPFLNNEKQ ERTE TTRT SLRARKR Sbjct: 61 LITIAIKQARILSLLPFLNNEKQFERTESTTRTTSLRARKR 101