BLASTX nr result
ID: Chrysanthemum22_contig00000065
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00000065 (784 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023744633.1| fimbrin-1 [Lactuca sativa] >gi|1322356467|gb... 76 7e-12 gb|ONK69248.1| uncharacterized protein A4U43_C05F20870 [Asparagu... 75 9e-12 ref|XP_020264201.1| fimbrin-5-like [Asparagus officinalis] 75 9e-12 gb|KZV36203.1| fimbrin-1 [Dorcoceras hygrometricum] 74 4e-11 emb|CDP13763.1| unnamed protein product [Coffea canephora] 73 6e-11 ref|XP_020110918.1| fimbrin-4-like [Ananas comosus] 73 8e-11 gb|OAY63267.1| Fimbrin-5 [Ananas comosus] 73 8e-11 ref|XP_015169174.1| PREDICTED: fimbrin-5 [Solanum tuberosum] 72 1e-10 gb|PLY87540.1| hypothetical protein LSAT_8X66921 [Lactuca sativa] 68 1e-10 ref|XP_015081826.1| PREDICTED: fimbrin-5 [Solanum pennellii] 72 1e-10 ref|XP_004243860.1| PREDICTED: fimbrin-5 [Solanum lycopersicum] 72 1e-10 gb|PHT72681.1| Fimbrin-4 [Capsicum annuum] 72 1e-10 ref|XP_016541430.1| PREDICTED: fimbrin-5 [Capsicum annuum] 72 1e-10 gb|OVA09239.1| Calponin homology domain [Macleaya cordata] 72 1e-10 ref|XP_022028589.1| fimbrin-1-like [Helianthus annuus] >gi|12287... 72 1e-10 ref|XP_008342163.1| PREDICTED: fimbrin-5-like [Malus domestica] 72 1e-10 ref|XP_015901274.1| PREDICTED: fimbrin-1-like [Ziziphus jujuba] ... 72 1e-10 ref|XP_016446607.1| PREDICTED: fimbrin-5-like [Nicotiana tabacum] 72 1e-10 ref|XP_009785665.1| PREDICTED: fimbrin-like protein 2 [Nicotiana... 72 1e-10 ref|XP_009593744.1| PREDICTED: fimbrin-5-like [Nicotiana tomento... 72 1e-10 >ref|XP_023744633.1| fimbrin-1 [Lactuca sativa] gb|PLY65539.1| hypothetical protein LSAT_9X90921 [Lactuca sativa] Length = 690 Score = 75.9 bits (185), Expect = 7e-12 Identities = 40/60 (66%), Positives = 44/60 (73%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYAYLLNVL PEHG+ LD KDPV RA LVL KRY+TPKDIVEGS N+ Sbjct: 298 KDGEAYAYLLNVLAPEHGNPATLDAKDPVQRADLVLHHAEKMDCKRYLTPKDIVEGSSNL 357 >gb|ONK69248.1| uncharacterized protein A4U43_C05F20870 [Asparagus officinalis] Length = 620 Score = 75.5 bits (184), Expect = 9e-12 Identities = 38/60 (63%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLV------LMWKRYITPKDIVEGSENI 298 +DGEAYAYLLN L PEH S ILD KDP ARA +V L KRY+TPKDIV+GS N+ Sbjct: 298 KDGEAYAYLLNALAPEHSSTEILDTKDPTARAQMVIEQAEKLDCKRYVTPKDIVDGSSNL 357 >ref|XP_020264201.1| fimbrin-5-like [Asparagus officinalis] Length = 661 Score = 75.5 bits (184), Expect = 9e-12 Identities = 38/60 (63%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLV------LMWKRYITPKDIVEGSENI 298 +DGEAYAYLLN L PEH S ILD KDP ARA +V L KRY+TPKDIV+GS N+ Sbjct: 298 KDGEAYAYLLNALAPEHSSTEILDTKDPTARAQMVIEQAEKLDCKRYVTPKDIVDGSSNL 357 >gb|KZV36203.1| fimbrin-1 [Dorcoceras hygrometricum] Length = 746 Score = 73.6 bits (179), Expect = 4e-11 Identities = 39/60 (65%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYAYLLNVL PEH + LDVKDP RA LVL KRY+TPKDIVEGS N+ Sbjct: 298 KDGEAYAYLLNVLAPEHCNTTTLDVKDPTERANLVLEHAEKMDCKRYLTPKDIVEGSANL 357 >emb|CDP13763.1| unnamed protein product [Coffea canephora] Length = 730 Score = 73.2 bits (178), Expect = 6e-11 Identities = 40/60 (66%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVL------MWKRYITPKDIVEGSENI 298 +DGEAYAYLLNVL PEH S LD KDPV RA LVL KRY+TPKDIVEGS N+ Sbjct: 298 KDGEAYAYLLNVLAPEHCSPATLDAKDPVQRANLVLDHAERMDCKRYLTPKDIVEGSTNL 357 >ref|XP_020110918.1| fimbrin-4-like [Ananas comosus] Length = 691 Score = 72.8 bits (177), Expect = 8e-11 Identities = 37/60 (61%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYAYLLN L PEH ++N LD KDP RA +VL KRY+TPKDIVEGS N+ Sbjct: 298 KDGEAYAYLLNALAPEHSTQNTLDTKDPNERAKMVLEQAEKLDCKRYLTPKDIVEGSANL 357 >gb|OAY63267.1| Fimbrin-5 [Ananas comosus] Length = 691 Score = 72.8 bits (177), Expect = 8e-11 Identities = 37/60 (61%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYAYLLN L PEH ++N LD KDP RA +VL KRY+TPKDIVEGS N+ Sbjct: 298 KDGEAYAYLLNALAPEHSTQNTLDTKDPNERAKMVLEQAEKLDCKRYLTPKDIVEGSANL 357 >ref|XP_015169174.1| PREDICTED: fimbrin-5 [Solanum tuberosum] Length = 578 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLV------LMWKRYITPKDIVEGSENI 298 +DGEAYA+LLN L PEHG+ N LD KDP RA L+ L KRY+TP+DIVEGS N+ Sbjct: 300 KDGEAYAHLLNALAPEHGTTNTLDTKDPTERANLIIEQAEKLDCKRYVTPQDIVEGSPNL 359 >gb|PLY87540.1| hypothetical protein LSAT_8X66921 [Lactuca sativa] Length = 133 Score = 68.2 bits (165), Expect = 1e-10 Identities = 37/60 (61%), Positives = 40/60 (66%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 QDGE YAYLLNVL PEH S + LD KDP RA LVL KRY+ KDIVEGS N+ Sbjct: 59 QDGETYAYLLNVLAPEHCSPSTLDTKDPTERANLVLEHVEKMDCKRYLASKDIVEGSANL 118 >ref|XP_015081826.1| PREDICTED: fimbrin-5 [Solanum pennellii] Length = 656 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLV------LMWKRYITPKDIVEGSENI 298 +DGEAYA+LLN L PEHG+ N LD KDP RA L+ L KRY+TP+DIVEGS N+ Sbjct: 300 KDGEAYAHLLNALAPEHGTTNTLDTKDPTERANLIIEQAEKLDCKRYVTPQDIVEGSPNL 359 >ref|XP_004243860.1| PREDICTED: fimbrin-5 [Solanum lycopersicum] Length = 656 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLV------LMWKRYITPKDIVEGSENI 298 +DGEAYA+LLN L PEHG+ N LD KDP RA L+ L KRY+TP+DIVEGS N+ Sbjct: 300 KDGEAYAHLLNALAPEHGTTNTLDTKDPTERANLIIEQAEKLDCKRYVTPQDIVEGSPNL 359 >gb|PHT72681.1| Fimbrin-4 [Capsicum annuum] Length = 661 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/60 (61%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYA+LLN L PEHG+ N LD +DP RA L+L KRYITPKDIVEGS N+ Sbjct: 298 KDGEAYAHLLNTLAPEHGTTNTLDTEDPSERANLILEQAEKLDCKRYITPKDIVEGSANL 357 >ref|XP_016541430.1| PREDICTED: fimbrin-5 [Capsicum annuum] Length = 661 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/60 (61%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYA+LLN L PEHG+ N LD +DP RA L+L KRYITPKDIVEGS N+ Sbjct: 298 KDGEAYAHLLNTLAPEHGTTNTLDTEDPSERANLILEQAEKLDCKRYITPKDIVEGSANL 357 >gb|OVA09239.1| Calponin homology domain [Macleaya cordata] Length = 679 Score = 72.4 bits (176), Expect = 1e-10 Identities = 39/60 (65%), Positives = 42/60 (70%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVL------MWKRYITPKDIVEGSENI 298 +DGEAYAYLLNVL PEH S LD KDP RA LVL KRYITPKDIV+GS N+ Sbjct: 303 KDGEAYAYLLNVLAPEHCSPTTLDTKDPTERAKLVLDHAEKMNCKRYITPKDIVDGSTNL 362 >ref|XP_022028589.1| fimbrin-1-like [Helianthus annuus] ref|XP_022028590.1| fimbrin-1-like [Helianthus annuus] ref|XP_022028591.1| fimbrin-1-like [Helianthus annuus] ref|XP_022028592.1| fimbrin-1-like [Helianthus annuus] ref|XP_022028593.1| fimbrin-1-like [Helianthus annuus] ref|XP_022028594.1| fimbrin-1-like [Helianthus annuus] ref|XP_022028595.1| fimbrin-1-like [Helianthus annuus] ref|XP_022028596.1| fimbrin-1-like [Helianthus annuus] gb|OTG31552.1| putative dystrophin [Helianthus annuus] Length = 687 Score = 72.4 bits (176), Expect = 1e-10 Identities = 39/60 (65%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYAYLLNVL PE+GS LD KDPV RA LVL KRY+TP DIVEGS N+ Sbjct: 299 KDGEAYAYLLNVLAPEYGSPATLDAKDPVERADLVLSHAEKMDCKRYLTPTDIVEGSANL 358 >ref|XP_008342163.1| PREDICTED: fimbrin-5-like [Malus domestica] Length = 691 Score = 72.4 bits (176), Expect = 1e-10 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYAYLLN L PEH LD+KDP ARA LVL KRY+TPKDIVEGS N+ Sbjct: 297 KDGEAYAYLLNALAPEHSGPAALDMKDPTARANLVLEQAEKLDCKRYLTPKDIVEGSPNL 356 >ref|XP_015901274.1| PREDICTED: fimbrin-1-like [Ziziphus jujuba] ref|XP_015901275.1| PREDICTED: fimbrin-1-like [Ziziphus jujuba] Length = 703 Score = 72.4 bits (176), Expect = 1e-10 Identities = 40/60 (66%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVL------MWKRYITPKDIVEGSENI 298 +DGEAYAYLLNVL PEH S LDVKDP RA LVL KRY+TPKDIVEGS N+ Sbjct: 298 KDGEAYAYLLNVLAPEHCSPATLDVKDPNERAKLVLDHAERMGCKRYLTPKDIVEGSSNL 357 >ref|XP_016446607.1| PREDICTED: fimbrin-5-like [Nicotiana tabacum] Length = 656 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYA+LLNVL PEHG+ LD KDP RA L+L KRY+TP+DIVEGS N+ Sbjct: 300 KDGEAYAHLLNVLAPEHGTTTTLDAKDPTERANLILEQAEKMDCKRYVTPQDIVEGSTNL 359 >ref|XP_009785665.1| PREDICTED: fimbrin-like protein 2 [Nicotiana sylvestris] ref|XP_016442341.1| PREDICTED: fimbrin-5-like [Nicotiana tabacum] ref|XP_016442342.1| PREDICTED: fimbrin-5-like [Nicotiana tabacum] Length = 656 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYA+LLNVL PEHG+ LD KDP RA L+L KRY+TP+DIVEGS N+ Sbjct: 300 KDGEAYAHLLNVLAPEHGTTTTLDAKDPTERANLILEQAEKMDCKRYVTPQDIVEGSTNL 359 >ref|XP_009593744.1| PREDICTED: fimbrin-5-like [Nicotiana tomentosiformis] ref|XP_018624358.1| PREDICTED: fimbrin-5-like [Nicotiana tomentosiformis] Length = 656 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 6/60 (10%) Frame = +2 Query: 137 QDGEAYAYLLNVLVPEHGSRNILDVKDPVARAYLVLM------WKRYITPKDIVEGSENI 298 +DGEAYA+LLNVL PEHG+ LD KDP RA L+L KRY+TP+DIVEGS N+ Sbjct: 300 KDGEAYAHLLNVLAPEHGTTTTLDTKDPTERANLILEQAEKMDCKRYVTPQDIVEGSTNL 359