BLASTX nr result
ID: Chrysanthemum21_contig00050780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00050780 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI06118.1| AAA+ ATPase domain-containing protein [Cynara car... 57 2e-06 gb|OTG16705.1| putative chaperone protein ClpD1 protein [Heliant... 56 2e-06 ref|XP_021984259.1| LOW QUALITY PROTEIN: chaperone protein ClpD,... 56 2e-06 ref|XP_010318683.1| PREDICTED: chaperone protein ClpD, chloropla... 56 2e-06 ref|XP_006341444.1| PREDICTED: chaperone protein ClpD, chloropla... 56 2e-06 ref|XP_006341443.1| PREDICTED: chaperone protein ClpD, chloropla... 56 2e-06 ref|XP_004235865.1| PREDICTED: chaperone protein ClpD, chloropla... 56 2e-06 ref|XP_015069697.1| PREDICTED: chaperone protein ClpD, chloropla... 56 2e-06 ref|XP_015069696.1| PREDICTED: chaperone protein ClpD, chloropla... 56 2e-06 ref|XP_021815208.1| chaperone protein ClpD, chloroplastic [Prunu... 55 4e-06 ref|XP_023744071.1| chaperone protein ClpD, chloroplastic [Lactu... 55 5e-06 gb|PHU24153.1| Chaperone protein ClpD, chloroplastic [Capsicum c... 55 5e-06 gb|PHT29298.1| Chaperone protein ClpD, chloroplastic [Capsicum b... 55 5e-06 ref|XP_016563020.1| PREDICTED: chaperone protein ClpD, chloropla... 55 5e-06 ref|XP_016449423.1| PREDICTED: chaperone protein ClpD, chloropla... 55 5e-06 ref|XP_009629145.1| PREDICTED: chaperone protein ClpD, chloropla... 55 5e-06 ref|XP_016449422.1| PREDICTED: chaperone protein ClpD, chloropla... 55 5e-06 ref|XP_016449421.1| PREDICTED: chaperone protein ClpD, chloropla... 55 5e-06 ref|XP_009629144.1| PREDICTED: chaperone protein ClpD, chloropla... 55 5e-06 ref|XP_009629143.1| PREDICTED: chaperone protein ClpD, chloropla... 55 5e-06 >gb|KVI06118.1| AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 886 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERV 317 AVASLWS +PIQ LT ++RMLLVGLDERLKERV Sbjct: 539 AVASLWSGIPIQQLTADDRMLLVGLDERLKERV 571 >gb|OTG16705.1| putative chaperone protein ClpD1 protein [Helianthus annuus] Length = 750 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 412 VASLWSWVPIQHLTTNERMLLVGLDERLKERV 317 VASLWS +PIQ LT +ERMLLVGLDERLKERV Sbjct: 404 VASLWSGIPIQQLTVDERMLLVGLDERLKERV 435 >ref|XP_021984259.1| LOW QUALITY PROTEIN: chaperone protein ClpD, chloroplastic-like [Helianthus annuus] Length = 949 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 412 VASLWSWVPIQHLTTNERMLLVGLDERLKERV 317 VASLWS +PIQ LT +ERMLLVGLDERLKERV Sbjct: 603 VASLWSGIPIQQLTVDERMLLVGLDERLKERV 634 >ref|XP_010318683.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X2 [Solanum lycopersicum] Length = 964 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 612 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKHPNRP 671 Query: 241 IES 233 I + Sbjct: 672 ISA 674 >ref|XP_006341444.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X2 [Solanum tuberosum] Length = 964 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 612 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKHPNRP 671 Query: 241 IES 233 I + Sbjct: 672 ISA 674 >ref|XP_006341443.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X1 [Solanum tuberosum] Length = 965 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 613 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKHPNRP 672 Query: 241 IES 233 I + Sbjct: 673 ISA 675 >ref|XP_004235865.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X1 [Solanum lycopersicum] Length = 965 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 613 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKHPNRP 672 Query: 241 IES 233 I + Sbjct: 673 ISA 675 >ref|XP_015069697.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X2 [Solanum pennellii] Length = 967 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 615 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKHPNRP 674 Query: 241 IES 233 I + Sbjct: 675 ISA 677 >ref|XP_015069696.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X1 [Solanum pennellii] Length = 968 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/63 (46%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 616 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKHPNRP 675 Query: 241 IES 233 I + Sbjct: 676 ISA 678 >ref|XP_021815208.1| chaperone protein ClpD, chloroplastic [Prunus avium] Length = 981 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/61 (45%), Positives = 41/61 (67%), Gaps = 2/61 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLWS +P+Q LT ++RMLLVGLDERL++R+ E + ++R++ + N P Sbjct: 631 AVASLWSGIPLQQLTADDRMLLVGLDERLRKRIVGQEEAVDAISRAVKRSRVGLKDPNRP 690 Query: 241 I 239 I Sbjct: 691 I 691 >ref|XP_023744071.1| chaperone protein ClpD, chloroplastic [Lactuca sativa] gb|PLY65938.1| hypothetical protein LSAT_4X85180 [Lactuca sativa] Length = 946 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERV 317 AVASLWS +PIQ LT +ERMLLVGL++RLKERV Sbjct: 599 AVASLWSGIPIQQLTADERMLLVGLEDRLKERV 631 >gb|PHU24153.1| Chaperone protein ClpD, chloroplastic [Capsicum chinense] Length = 956 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 604 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKDPNRP 663 Query: 241 IES 233 + + Sbjct: 664 MSA 666 >gb|PHT29298.1| Chaperone protein ClpD, chloroplastic [Capsicum baccatum] Length = 956 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 604 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKDPNRP 663 Query: 241 IES 233 + + Sbjct: 664 MSA 666 >ref|XP_016563020.1| PREDICTED: chaperone protein ClpD, chloroplastic [Capsicum annuum] gb|PHT88537.1| Chaperone protein ClpD, chloroplastic [Capsicum annuum] Length = 956 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+LK+RV + T + ++R++T + N P Sbjct: 604 AVASLWTGIPLKQLTVDERMLLVGLDEQLKKRVVGQDEAVTSICRAVKRSRTGLKDPNRP 663 Query: 241 IES 233 + + Sbjct: 664 MSA 666 >ref|XP_016449423.1| PREDICTED: chaperone protein ClpD, chloroplastic-like isoform X4 [Nicotiana tabacum] Length = 968 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+L++RV + T + ++R++T + N P Sbjct: 616 AVASLWTGIPLKQLTVDERMLLVGLDEQLRKRVVGQDEAVTAICRAVKRSRTGLKDPNRP 675 Query: 241 IES 233 I + Sbjct: 676 ISA 678 >ref|XP_009629145.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X4 [Nicotiana tomentosiformis] Length = 968 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+L++RV + T + ++R++T + N P Sbjct: 616 AVASLWTGIPLKQLTVDERMLLVGLDEQLRKRVVGQDEAVTAICRAVKRSRTGLKDPNRP 675 Query: 241 IES 233 I + Sbjct: 676 ISA 678 >ref|XP_016449422.1| PREDICTED: chaperone protein ClpD, chloroplastic-like isoform X3 [Nicotiana tabacum] Length = 969 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+L++RV + T + ++R++T + N P Sbjct: 617 AVASLWTGIPLKQLTVDERMLLVGLDEQLRKRVVGQDEAVTAICRAVKRSRTGLKDPNRP 676 Query: 241 IES 233 I + Sbjct: 677 ISA 679 >ref|XP_016449421.1| PREDICTED: chaperone protein ClpD, chloroplastic-like isoform X2 [Nicotiana tabacum] Length = 969 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+L++RV + T + ++R++T + N P Sbjct: 617 AVASLWTGIPLKQLTVDERMLLVGLDEQLRKRVVGQDEAVTAICRAVKRSRTGLKDPNRP 676 Query: 241 IES 233 I + Sbjct: 677 ISA 679 >ref|XP_009629144.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X3 [Nicotiana tomentosiformis] Length = 969 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+L++RV + T + ++R++T + N P Sbjct: 617 AVASLWTGIPLKQLTVDERMLLVGLDEQLRKRVVGQDEAVTAICRAVKRSRTGLKDPNRP 676 Query: 241 IES 233 I + Sbjct: 677 ISA 679 >ref|XP_009629143.1| PREDICTED: chaperone protein ClpD, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 969 Score = 55.1 bits (131), Expect = 5e-06 Identities = 28/63 (44%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = -1 Query: 415 AVASLWSWVPIQHLTTNERMLLVGLDERLKERVA--ENPRTFVGENLQRTQTRNSNKNEP 242 AVASLW+ +P++ LT +ERMLLVGLDE+L++RV + T + ++R++T + N P Sbjct: 617 AVASLWTGIPLKQLTVDERMLLVGLDEQLRKRVVGQDEAVTAICRAVKRSRTGLKDPNRP 676 Query: 241 IES 233 I + Sbjct: 677 ISA 679