BLASTX nr result
ID: Chrysanthemum21_contig00050753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00050753 (570 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIA44340.1| hypothetical protein AQUCO_01700145v1 [Aquilegia ... 58 8e-07 dbj|GAV87896.1| hypothetical protein CFOL_v3_31320 [Cephalotus f... 55 5e-06 >gb|PIA44340.1| hypothetical protein AQUCO_01700145v1 [Aquilegia coerulea] Length = 216 Score = 57.8 bits (138), Expect = 8e-07 Identities = 32/81 (39%), Positives = 45/81 (55%) Frame = -3 Query: 565 MSKTHFLLQKKLHELESEFTHVSKCLPETITGPDPIVDEFKNRLVFYRKLLTAEIAVHKT 386 M+K + ++QKKL ELESE V LP T + + + F R LL AEI H + Sbjct: 1 MTKRYAVIQKKLEELESELNDVVN-LPTETTSHQLLSENINQKFSFLRNLLAAEIESHPS 59 Query: 385 KPPHLDEYEKCLAQLETSFNK 323 KP HL ++ L +LET F++ Sbjct: 60 KPHHLHHMDQRLTELETEFHE 80 >dbj|GAV87896.1| hypothetical protein CFOL_v3_31320 [Cephalotus follicularis] Length = 200 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/81 (37%), Positives = 48/81 (59%) Frame = -3 Query: 565 MSKTHFLLQKKLHELESEFTHVSKCLPETITGPDPIVDEFKNRLVFYRKLLTAEIAVHKT 386 M+K + +L++KL ELE++ + T D + + VF + LL+AEIA+H + Sbjct: 1 MTKNYTILRRKLQELETKLDEAVSLPQQEHTQFD--AQDIEQSFVFLKNLLSAEIALHPS 58 Query: 385 KPPHLDEYEKCLAQLETSFNK 323 KP HL+ + L +LETSF+K Sbjct: 59 KPRHLNHMDNRLTELETSFHK 79