BLASTX nr result
ID: Chrysanthemum21_contig00050712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00050712 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF96852.1| hypothetical protein HannXRQ_Chr14g0428091 [Helia... 93 4e-22 >gb|OTF96852.1| hypothetical protein HannXRQ_Chr14g0428091 [Helianthus annuus] Length = 91 Score = 93.2 bits (230), Expect = 4e-22 Identities = 46/88 (52%), Positives = 53/88 (60%), Gaps = 1/88 (1%) Frame = -1 Query: 388 MAKLLRTNTITFCFMALTLFIGLDCTKNASVKRYEDSKSLPRNEKLGSLICKSYG-PVLH 212 MAK +RT I C M LTL +GLD T+ A + + D S P NEKLG +C Y P LH Sbjct: 1 MAKHIRTYAIISCLMFLTLLVGLDSTRVAVSEEHGDDISTPTNEKLGWPVCSYYDRPGLH 60 Query: 211 YCCCEGQSECFDTRKMCISYCVKHHPTC 128 YCCC QSECFDT + CI YC H C Sbjct: 61 YCCCRDQSECFDTVERCIQYCDSHPRIC 88