BLASTX nr result
ID: Chrysanthemum21_contig00050528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00050528 (443 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY63203.1| hypothetical protein LSAT_6X60701 [Lactuca sativa] 85 3e-18 gb|KVH90982.1| Pathogenic type III effector avirulence factor Av... 88 4e-18 ref|XP_023747760.1| RPM1-interacting protein 4-like [Lactuca sat... 83 2e-17 ref|XP_022026685.1| RPM1-interacting protein 4-like isoform X2 [... 82 7e-17 ref|XP_022026684.1| RPM1-interacting protein 4-like isoform X1 [... 82 3e-16 ref|XP_022016583.1| RPM1-interacting protein 4-like isoform X2 [... 72 3e-12 ref|XP_022016582.1| RPM1-interacting protein 4-like isoform X1 [... 72 4e-12 ref|XP_023745715.1| RPM1-interacting protein 4-like isoform X2 [... 67 1e-10 ref|XP_023745714.1| RPM1-interacting protein 4-like isoform X1 [... 67 1e-10 gb|KVI08250.1| Pathogenic type III effector avirulence factor Av... 67 3e-10 ref|XP_011101988.1| RPM1-interacting protein 4 [Sesamum indicum] 62 2e-08 emb|CDP11146.1| unnamed protein product [Coffea canephora] 62 2e-08 gb|PIN21961.1| hypothetical protein CDL12_05337 [Handroanthus im... 62 3e-08 emb|CBI17269.3| unnamed protein product, partial [Vitis vinifera] 60 3e-08 dbj|GAU25883.1| hypothetical protein TSUD_164240 [Trifolium subt... 60 3e-08 gb|PHT33005.1| hypothetical protein CQW23_29342, partial [Capsic... 60 7e-08 ref|XP_016551465.1| PREDICTED: RPM1-interacting protein 4-like i... 60 7e-08 ref|XP_006349918.1| PREDICTED: RPM1-interacting protein 4-like [... 60 7e-08 ref|XP_019075253.1| PREDICTED: RPM1-interacting protein 4 isofor... 60 7e-08 ref|XP_002263352.2| PREDICTED: RPM1-interacting protein 4 isofor... 60 7e-08 >gb|PLY63203.1| hypothetical protein LSAT_6X60701 [Lactuca sativa] Length = 146 Score = 85.1 bits (209), Expect = 3e-18 Identities = 45/90 (50%), Positives = 56/90 (62%), Gaps = 2/90 (2%) Frame = +3 Query: 75 GHEEPRGYST*MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKH--D 248 G P G S +R +T DD T V VFGDWDDS P SAEGY HI NKV+E+KH Sbjct: 50 GTAAPPGGSR-LRQVTLGDDSPDDGTAVPVFGDWDDSDPASAEGYSHIFNKVREEKHGGG 108 Query: 249 AGGKSPRTTSNDSTFYGQKAYKKGEETESR 338 GGKSPR ++DS++YGQ+ K + +R Sbjct: 109 GGGKSPRLNTDDSSYYGQRPEAKKSQVSTR 138 >gb|KVH90982.1| Pathogenic type III effector avirulence factor Avr cleavage site-containing protein, partial [Cynara cardunculus var. scolymus] Length = 290 Score = 88.2 bits (217), Expect = 4e-18 Identities = 42/70 (60%), Positives = 49/70 (70%) Frame = +3 Query: 108 MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDS 287 +R +T DDST V VFGDWDDS P SAEGY HI NKV+E+KH GGKSPR TS+DS Sbjct: 123 LRQVTLGDETPDDSTAVPVFGDWDDSDPASAEGYSHIFNKVREEKHSGGGKSPRITSDDS 182 Query: 288 TFYGQKAYKK 317 F+ Q+ K Sbjct: 183 YFHSQRPEAK 192 >ref|XP_023747760.1| RPM1-interacting protein 4-like [Lactuca sativa] Length = 142 Score = 82.8 bits (203), Expect = 2e-17 Identities = 44/83 (53%), Positives = 53/83 (63%), Gaps = 2/83 (2%) Frame = +3 Query: 75 GHEEPRGYST*MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKH--D 248 G P G S +R +T DD T V VFGDWDDS P SAEGY HI NKV+E+KH Sbjct: 50 GTAAPPGGSR-LRQVTLGDDSPDDGTAVPVFGDWDDSDPASAEGYSHIFNKVREEKHGGG 108 Query: 249 AGGKSPRTTSNDSTFYGQKAYKK 317 GGKSPR ++DS++YGQ+ K Sbjct: 109 GGGKSPRLNTDDSSYYGQRPEAK 131 >ref|XP_022026685.1| RPM1-interacting protein 4-like isoform X2 [Helianthus annuus] gb|OTG35653.1| putative RIN4, pathogenic type III effector avirulence factor Avr cleavage site [Helianthus annuus] Length = 170 Score = 82.4 bits (202), Expect = 7e-17 Identities = 39/70 (55%), Positives = 48/70 (68%) Frame = +3 Query: 108 MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDS 287 +R +T DDST V VFGDWDD+ P SAEGY I +KV+E+KH GGKSPR TS++S Sbjct: 90 LRQVTLGDESPDDSTAVPVFGDWDDNDPASAEGYSTIFDKVREEKHGGGGKSPRITSDNS 149 Query: 288 TFYGQKAYKK 317 FYG + K Sbjct: 150 NFYGHRPEAK 159 >ref|XP_022026684.1| RPM1-interacting protein 4-like isoform X1 [Helianthus annuus] Length = 242 Score = 82.4 bits (202), Expect = 3e-16 Identities = 39/70 (55%), Positives = 48/70 (68%) Frame = +3 Query: 108 MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDS 287 +R +T DDST V VFGDWDD+ P SAEGY I +KV+E+KH GGKSPR TS++S Sbjct: 90 LRQVTLGDESPDDSTAVPVFGDWDDNDPASAEGYSTIFDKVREEKHGGGGKSPRITSDNS 149 Query: 288 TFYGQKAYKK 317 FYG + K Sbjct: 150 NFYGHRPEAK 159 >ref|XP_022016583.1| RPM1-interacting protein 4-like isoform X2 [Helianthus annuus] gb|OTF90376.1| putative RIN4, pathogenic type III effector avirulence factor Avr cleavage site [Helianthus annuus] Length = 233 Score = 71.6 bits (174), Expect = 3e-12 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = +3 Query: 138 LDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQKAYK 314 +DD + FGDWDD+ P SAEGY + NK + DKH GGKSP TS ++ ++GQ+ K Sbjct: 163 VDDGPAIPKFGDWDDNDPASAEGYTEVFNKARHDKHAGGGKSPMITSENTNYFGQRKEK 221 >ref|XP_022016582.1| RPM1-interacting protein 4-like isoform X1 [Helianthus annuus] Length = 250 Score = 71.6 bits (174), Expect = 4e-12 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = +3 Query: 138 LDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQKAYK 314 +DD + FGDWDD+ P SAEGY + NK + DKH GGKSP TS ++ ++GQ+ K Sbjct: 180 VDDGPAIPKFGDWDDNDPASAEGYTEVFNKARHDKHAGGGKSPMITSENTNYFGQRKEK 238 >ref|XP_023745715.1| RPM1-interacting protein 4-like isoform X2 [Lactuca sativa] Length = 238 Score = 67.4 bits (163), Expect = 1e-10 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = +3 Query: 141 DDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQ 302 DD + FG WD+ P SAE Y HI NK +ED+H+ GGKSP ++++ FYGQ Sbjct: 167 DDGPAIPKFGGWDEKDPASAEAYTHIFNKAREDRHNGGGKSPMVSTDNVDFYGQ 220 >ref|XP_023745714.1| RPM1-interacting protein 4-like isoform X1 [Lactuca sativa] gb|PLY64817.1| hypothetical protein LSAT_2X46760 [Lactuca sativa] Length = 239 Score = 67.4 bits (163), Expect = 1e-10 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = +3 Query: 141 DDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQ 302 DD + FG WD+ P SAE Y HI NK +ED+H+ GGKSP ++++ FYGQ Sbjct: 168 DDGPAIPKFGGWDEKDPASAEAYTHIFNKAREDRHNGGGKSPMVSTDNVDFYGQ 221 >gb|KVI08250.1| Pathogenic type III effector avirulence factor Avr cleavage site-containing protein [Cynara cardunculus var. scolymus] Length = 313 Score = 67.0 bits (162), Expect = 3e-10 Identities = 27/68 (39%), Positives = 41/68 (60%) Frame = +3 Query: 108 MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDS 287 ++ +T +DD + FGDWDD+ P + EGY + NK +ED+H+ G KSP T ++ Sbjct: 186 LKQVTRGEETVDDGPAIPKFGDWDDNDPTAGEGYTQLFNKAREDRHNGGAKSPMITIENA 245 Query: 288 TFYGQKAY 311 FYGQ + Sbjct: 246 NFYGQNRH 253 >ref|XP_011101988.1| RPM1-interacting protein 4 [Sesamum indicum] Length = 310 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/57 (50%), Positives = 35/57 (61%) Frame = +3 Query: 141 DDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQKAY 311 D S V FGDWD++ P SAEGY HI N+V+E+KH GK P + S GQK Y Sbjct: 238 DRSPAVPKFGDWDETNPASAEGYTHIFNRVREEKHSDTGKVPVVPTETSHSNGQKQY 294 >emb|CDP11146.1| unnamed protein product [Coffea canephora] Length = 311 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/55 (50%), Positives = 34/55 (61%) Frame = +3 Query: 141 DDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQK 305 D S V FGDWD++ P SAEGY HI NKV+E++H GK P + S GQK Sbjct: 240 DHSPAVPKFGDWDETDPASAEGYTHIFNKVREERHSGAGKVPGMPTESSYSNGQK 294 >gb|PIN21961.1| hypothetical protein CDL12_05337 [Handroanthus impetiginosus] Length = 307 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/84 (36%), Positives = 44/84 (52%) Frame = +3 Query: 72 YGHEEPRGYST*MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDA 251 +GH + +R +T DDS V FG+WD++ P +AEGY I NKV+E+KH Sbjct: 212 HGHAPTTPGRSRLRSVTRGESMPDDSPAVPRFGEWDETDPAAAEGYTQIFNKVREEKHSE 271 Query: 252 GGKSPRTTSNDSTFYGQKAYKKGE 323 GK P + S QK Y+ + Sbjct: 272 TGKVPTVPTETSYSIDQKLYRNDD 295 >emb|CBI17269.3| unnamed protein product, partial [Vitis vinifera] Length = 219 Score = 60.5 bits (145), Expect = 3e-08 Identities = 32/70 (45%), Positives = 38/70 (54%) Frame = +3 Query: 108 MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDS 287 +R T + K DDST V FGDWD+ P SAEGY HI NKV E+K G P + S Sbjct: 136 LRPATQGNRKPDDSTAVPKFGDWDERNPSSAEGYTHIFNKVHEEKQRVEGTVPAMVTEPS 195 Query: 288 TFYGQKAYKK 317 G + Y K Sbjct: 196 YPSGPEQYGK 205 >dbj|GAU25883.1| hypothetical protein TSUD_164240 [Trifolium subterraneum] Length = 220 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = +3 Query: 141 DDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDS 287 D S V FGDWD+S P SA+GY HI NKV+E+KH A G +P T + S Sbjct: 150 DKSAAVPKFGDWDESDPASADGYTHIFNKVREEKHVAAGHAPGTPNGRS 198 >gb|PHT33005.1| hypothetical protein CQW23_29342, partial [Capsicum baccatum] Length = 313 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = +3 Query: 141 DDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQKAY 311 DDS V FGDWD++ P SAEGY I NKV+E+K K P T+++ S QK Y Sbjct: 241 DDSPAVPKFGDWDENDPASAEGYTQIFNKVREEKQTGAAKVPATSTDTSYSNSQKRY 297 >ref|XP_016551465.1| PREDICTED: RPM1-interacting protein 4-like isoform X2 [Capsicum annuum] Length = 313 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = +3 Query: 141 DDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQKAY 311 DDS V FGDWD++ P SAEGY I NKV+E+K K P T+++ S QK Y Sbjct: 241 DDSPAVPKFGDWDENDPASAEGYTQIFNKVREEKQTGAAKVPATSTDTSYSNSQKRY 297 >ref|XP_006349918.1| PREDICTED: RPM1-interacting protein 4-like [Solanum tuberosum] Length = 313 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = +3 Query: 141 DDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDSTFYGQKAY 311 DDS V FGDWD++ P SAEGY I NKV+E+K K P T+++ S QK Y Sbjct: 241 DDSPAVPKFGDWDENDPASAEGYTQIFNKVREEKQTGSAKVPSTSTDTSYSNSQKRY 297 >ref|XP_019075253.1| PREDICTED: RPM1-interacting protein 4 isoform X2 [Vitis vinifera] Length = 328 Score = 60.5 bits (145), Expect = 7e-08 Identities = 32/70 (45%), Positives = 38/70 (54%) Frame = +3 Query: 108 MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDS 287 +R T + K DDST V FGDWD+ P SAEGY HI NKV E+K G P + S Sbjct: 245 LRPATQGNRKPDDSTAVPKFGDWDERNPSSAEGYTHIFNKVHEEKQRVEGTVPAMVTEPS 304 Query: 288 TFYGQKAYKK 317 G + Y K Sbjct: 305 YPSGPEQYGK 314 >ref|XP_002263352.2| PREDICTED: RPM1-interacting protein 4 isoform X1 [Vitis vinifera] Length = 329 Score = 60.5 bits (145), Expect = 7e-08 Identities = 32/70 (45%), Positives = 38/70 (54%) Frame = +3 Query: 108 MRLITY*HVKLDDSTGVHVFGDWDDSQPGSAEGYWHILNKVQEDKHDAGGKSPRTTSNDS 287 +R T + K DDST V FGDWD+ P SAEGY HI NKV E+K G P + S Sbjct: 246 LRPATQGNRKPDDSTAVPKFGDWDERNPSSAEGYTHIFNKVHEEKQRVEGTVPAMVTEPS 305 Query: 288 TFYGQKAYKK 317 G + Y K Sbjct: 306 YPSGPEQYGK 315