BLASTX nr result
ID: Chrysanthemum21_contig00050379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00050379 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY78700.1| hypothetical protein LSAT_9X46760 [Lactuca sativa] 70 1e-13 >gb|PLY78700.1| hypothetical protein LSAT_9X46760 [Lactuca sativa] Length = 84 Score = 70.5 bits (171), Expect = 1e-13 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 3/86 (3%) Frame = +2 Query: 26 MHLIKFIVVLVIITTFSS--SPVASRGIGINWDGKKFCTEMTCDPLNESSTIQCDNTCIP 199 M+ +KF ++L+I+T S+ + A++G+ NWDG+KFC+ M C + C CIP Sbjct: 1 MNQMKFFILLLILTITSAWATKEATKGLVPNWDGRKFCSTMVCK--MGTGDAFCTEDCIP 58 Query: 200 RGWKVGECISPPD-SSAAGHCCCYTP 274 RGW G+C P + G+CCC+TP Sbjct: 59 RGWTNGQCDHLPGITGDTGNCCCWTP 84