BLASTX nr result
ID: Chrysanthemum21_contig00049870
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00049870 (443 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93962.1| hypothetical protein Ccrd_003978 [Cynara carduncu... 53 1e-06 >gb|KVH93962.1| hypothetical protein Ccrd_003978 [Cynara cardunculus var. scolymus] Length = 696 Score = 52.8 bits (125), Expect(2) = 1e-06 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +2 Query: 74 GDSIVFYITGTVERMLDSVSETR*IAVGFICRIKLKAVNYLL 199 G +VF +T E M DSVS TR IAVGFIC+IKLK V YLL Sbjct: 585 GACVVFLLTDIAENMSDSVSGTREIAVGFICQIKLKVVKYLL 626 Score = 27.3 bits (59), Expect(2) = 1e-06 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 223 KLFIIDLLNKFLKWLFDFEIDQNN 294 KL ++ L K +K L FEIDQNN Sbjct: 618 KLKVVKYLLKCVKRLLQFEIDQNN 641