BLASTX nr result
ID: Chrysanthemum21_contig00049722
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00049722 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY74244.1| hypothetical protein LSAT_1X66140 [Lactuca sativa] 69 2e-12 >gb|PLY74244.1| hypothetical protein LSAT_1X66140 [Lactuca sativa] Length = 70 Score = 68.6 bits (166), Expect = 2e-12 Identities = 36/62 (58%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Frame = -3 Query: 402 MASNGVFRSAFIAFFILLISATAVFGRDI-EYSMAPAPAPMDTGSASATTISMVFVSAAF 226 MAS G R+A + FIL+ISATA RD E+S+APAPAPM+ GSA T+SMV VSA+ Sbjct: 1 MASGGALRTAIVGLFILVISATAAAARDYAEFSLAPAPAPMEAGSAVPMTLSMVVVSASL 60 Query: 225 LL 220 L+ Sbjct: 61 LI 62