BLASTX nr result
ID: Chrysanthemum21_contig00049372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00049372 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021649598.1| uncharacterized protein LOC110641989 [Hevea ... 56 4e-06 ref|XP_021987130.1| uncharacterized protein LOC110883789 [Helian... 56 4e-06 >ref|XP_021649598.1| uncharacterized protein LOC110641989 [Hevea brasiliensis] Length = 778 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 3 YIMDVATPTDDCLSLVYDLLSPFMMKEPSNSKLSNLEVR 119 YIMDVATPT DCL+LVYDLL P +MK SNS LS+ E R Sbjct: 666 YIMDVATPTADCLTLVYDLLMPVIMKGHSNSTLSHQENR 704 >ref|XP_021987130.1| uncharacterized protein LOC110883789 [Helianthus annuus] gb|OTG09586.1| hypothetical protein HannXRQ_Chr10g0278081 [Helianthus annuus] Length = 1211 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +3 Query: 3 YIMDVATPTDDCLSLVYDLLSPFMMKEPSNSKLSNLEVR 119 YIMDVATPT DCLSLVYDLL P MMK S S LS+ E R Sbjct: 638 YIMDVATPTADCLSLVYDLLLPVMMKGHSKSTLSHQENR 676