BLASTX nr result
ID: Chrysanthemum21_contig00049363
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00049363 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY74244.1| hypothetical protein LSAT_1X66140 [Lactuca sativa] 76 8e-16 >gb|PLY74244.1| hypothetical protein LSAT_1X66140 [Lactuca sativa] Length = 70 Score = 75.9 bits (185), Expect = 8e-16 Identities = 42/71 (59%), Positives = 53/71 (74%), Gaps = 1/71 (1%) Frame = +1 Query: 7 MASNGVCKSAFIAFFVLLISATAVFARDI-EYSMAPDPAPMDTGSASSTTISMVFVSAAF 183 MAS G ++A + F+L+ISATA ARD E+S+AP PAPM+ GSA T+SMV VSA+ Sbjct: 1 MASGGALRTAIVGLFILVISATAAAARDYAEFSLAPAPAPMEAGSAVPMTLSMVVVSAS- 59 Query: 184 LLLSLNGVIFH 216 LL+SL GVIFH Sbjct: 60 LLISLAGVIFH 70