BLASTX nr result
ID: Chrysanthemum21_contig00049360
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00049360 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY96166.1| hypothetical protein LSAT_8X155761 [Lactuca sativa] 57 5e-07 ref|XP_023748913.1| LOW QUALITY PROTEIN: ankyrin repeat-containi... 57 5e-07 >gb|PLY96166.1| hypothetical protein LSAT_8X155761 [Lactuca sativa] Length = 569 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 19/60 (31%) Frame = +3 Query: 9 FVQYRNGLKWVPVLL-------------------VDMFRSMYDLRYLFKLKKCMLYNTNP 131 FV YRNGLKWVP+++ +DMFRSMYD RY+F K+ MLYN NP Sbjct: 508 FVLYRNGLKWVPIIIGILAAMPVIVFAALQFPVWLDMFRSMYDSRYIFHPKRNMLYNKNP 567 >ref|XP_023748913.1| LOW QUALITY PROTEIN: ankyrin repeat-containing protein At5g02620-like [Lactuca sativa] Length = 598 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 19/60 (31%) Frame = +3 Query: 9 FVQYRNGLKWVPVLL-------------------VDMFRSMYDLRYLFKLKKCMLYNTNP 131 FV YRNGLKWVP+++ +DMFRSMYD RY+F K+ MLYN NP Sbjct: 537 FVLYRNGLKWVPIIIGILAAMPVIVFAALQFPVWLDMFRSMYDSRYIFHPKRNMLYNKNP 596