BLASTX nr result
ID: Chrysanthemum21_contig00048999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00048999 (551 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023767366.1| probable protein phosphatase 2C 47 isoform X... 58 2e-06 >ref|XP_023767366.1| probable protein phosphatase 2C 47 isoform X1 [Lactuca sativa] gb|PLY82752.1| hypothetical protein LSAT_2X73801 [Lactuca sativa] Length = 383 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/52 (48%), Positives = 30/52 (57%) Frame = +1 Query: 385 MGPGTDVWPQCASLDNRYPRXXXXXXXXXXXXXXXXNVNQEKSTKPPRNGPP 540 MGPGTDVWP C SLDNR+ R ++++ K KPPRNGPP Sbjct: 1 MGPGTDVWPHCTSLDNRHSRECMPAMIEDEDPEDFDHLSETKFAKPPRNGPP 52