BLASTX nr result
ID: Chrysanthemum21_contig00048943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00048943 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022039672.1| kunitz trypsin inhibitor 2-like [Helianthus ... 98 8e-23 gb|KVI09680.1| Kunitz inhibitor ST1-like protein [Cynara cardunc... 102 8e-23 ref|XP_021810339.1| kunitz trypsin inhibitor 2-like [Prunus avium] 97 2e-22 ref|XP_020419805.1| kunitz trypsin inhibitor 2 [Prunus persica] ... 97 2e-22 gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri... 97 2e-22 ref|XP_002266302.2| PREDICTED: kunitz trypsin inhibitor 2, parti... 95 3e-22 dbj|BAA05474.1| tumor-related protein, partial [Nicotiana glauca... 94 4e-22 gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianth... 95 5e-22 emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera] 95 9e-22 emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera] 95 9e-22 ref|XP_002270111.1| PREDICTED: kunitz trypsin inhibitor 2 [Vitis... 95 9e-22 gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana] 95 9e-22 ref|XP_019230715.1| PREDICTED: kunitz trypsin inhibitor 2 [Nicot... 94 3e-21 ref|NP_001312135.1| miraculin-like precursor [Nicotiana tabacum]... 94 3e-21 ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris] 94 3e-21 gb|OMP05594.1| Proteinase inhibitor I3, Kunitz legume [Corchorus... 94 4e-21 ref|XP_016512642.1| PREDICTED: miraculin-like [Nicotiana tabacum] 94 4e-21 gb|ONI06686.1| hypothetical protein PRUPE_5G074500 [Prunus persica] 94 4e-21 ref|XP_007211211.1| kunitz trypsin inhibitor 2 [Prunus persica] 94 4e-21 gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianth... 92 5e-21 >ref|XP_022039672.1| kunitz trypsin inhibitor 2-like [Helianthus annuus] gb|OTG26682.1| putative kunitz family trypsin and protease inhibitor protein [Helianthus annuus] Length = 217 Score = 98.2 bits (243), Expect = 8e-23 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK++ DYKLVFCPTVC+FC+ VCGDIGV I ENG RRL ISDVPFKVMF+KA Sbjct: 163 FKIEKYEDDYKLVFCPTVCDFCRPVCGDIGVTITENGIRRLVISDVPFKVMFRKA 217 >gb|KVI09680.1| Kunitz inhibitor ST1-like protein [Cynara cardunculus var. scolymus] Length = 529 Score = 102 bits (254), Expect = 8e-23 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKI K++ DYKLVFCPTVCN+CK VCGDIGVKIAENG RRLAISDVPFKV F+KA Sbjct: 475 FKIAKYENDYKLVFCPTVCNYCKPVCGDIGVKIAENGSRRLAISDVPFKVKFRKA 529 Score = 85.9 bits (211), Expect = 6e-17 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKV 237 FKIEK++ DYK+VFCPTVC+FC+ VCGDIGV I E+G RRLAI DVPFK+ Sbjct: 142 FKIEKYEDDYKIVFCPTVCDFCRPVCGDIGVIIGEDGSRRLAIRDVPFKM 191 Score = 76.6 bits (187), Expect = 1e-13 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDV 249 FKI K++ DYKLVFCPTVCN+CK VCGDIGVKIAENG R I V Sbjct: 332 FKIAKYENDYKLVFCPTVCNYCKPVCGDIGVKIAENGSRHYYILPV 377 >ref|XP_021810339.1| kunitz trypsin inhibitor 2-like [Prunus avium] Length = 204 Score = 97.1 bits (240), Expect = 2e-22 Identities = 43/55 (78%), Positives = 52/55 (94%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK+D+DYKLVFCPTVCNFCKV+C D+G+ I ++GKRRLA++DVPFKVMFKKA Sbjct: 151 FKIEKYDEDYKLVFCPTVCNFCKVICRDVGIFI-QDGKRRLALTDVPFKVMFKKA 204 >ref|XP_020419805.1| kunitz trypsin inhibitor 2 [Prunus persica] gb|ONI06685.1| hypothetical protein PRUPE_5G074400 [Prunus persica] Length = 204 Score = 97.1 bits (240), Expect = 2e-22 Identities = 43/55 (78%), Positives = 52/55 (94%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK+D+DYKLVFCPTVCNFCKV+C D+G+ I ++GKRRLA++DVPFKVMFKKA Sbjct: 151 FKIEKYDEDYKLVFCPTVCNFCKVICRDVGIFI-QDGKRRLALTDVPFKVMFKKA 204 >gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia] Length = 203 Score = 96.7 bits (239), Expect = 2e-22 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK+D DYKLVFCPTVC+FCK VCGDIG+ I +NG RRLA+SDVPFKVMFKKA Sbjct: 150 FKIEKYDDDYKLVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 203 >ref|XP_002266302.2| PREDICTED: kunitz trypsin inhibitor 2, partial [Vitis vinifera] Length = 162 Score = 95.1 bits (235), Expect = 3e-22 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK++ DYKLVFCPTVC+FCK VCGDIG+ I +NG RRLA+SDVPFKVMFKKA Sbjct: 109 FKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 162 >dbj|BAA05474.1| tumor-related protein, partial [Nicotiana glauca x Nicotiana langsdorffii] Length = 125 Score = 94.0 bits (232), Expect = 4e-22 Identities = 42/55 (76%), Positives = 51/55 (92%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEKF++DYKLV+CPTVCNFCKV+C D+G+ I ++G RRLA+SDVPFKVMFKKA Sbjct: 72 FKIEKFERDYKLVYCPTVCNFCKVICKDVGIFI-QDGIRRLALSDVPFKVMFKKA 125 >gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus] Length = 161 Score = 94.7 bits (234), Expect = 5e-22 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK++ DYKLV+CPTVC+ C+ VCGDIGV AENG RRLAISDVPFK+ F+KA Sbjct: 107 FKIEKYENDYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA 161 >emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera] Length = 203 Score = 95.1 bits (235), Expect = 9e-22 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK++ DYKLVFCPTVC+FCK VCGDIG+ I +NG RRLA+SDVPFKVMFKKA Sbjct: 150 FKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 203 >emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera] Length = 203 Score = 95.1 bits (235), Expect = 9e-22 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK++ DYKLVFCPTVC+FCK VCGDIG+ I +NG RRLA+SDVPFKVMFKKA Sbjct: 150 FKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 203 >ref|XP_002270111.1| PREDICTED: kunitz trypsin inhibitor 2 [Vitis vinifera] emb|CBI35474.3| unnamed protein product, partial [Vitis vinifera] Length = 203 Score = 95.1 bits (235), Expect = 9e-22 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK++ DYKLVFCPTVC+FCK VCGDIG+ I +NG RRLA+SDVPFKVMFKKA Sbjct: 150 FKIEKYEDDYKLVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA 203 >gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana] Length = 205 Score = 95.1 bits (235), Expect = 9e-22 Identities = 43/55 (78%), Positives = 51/55 (92%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEKF++DYKLV+CPTVCNFCKV+C DIG+ I ++G RRLA+SDVPFKVMFKKA Sbjct: 152 FKIEKFERDYKLVYCPTVCNFCKVICKDIGIFI-QDGTRRLALSDVPFKVMFKKA 205 >ref|XP_019230715.1| PREDICTED: kunitz trypsin inhibitor 2 [Nicotiana attenuata] gb|OIT29241.1| 21 kda seed protein [Nicotiana attenuata] Length = 205 Score = 94.0 bits (232), Expect = 3e-21 Identities = 42/55 (76%), Positives = 51/55 (92%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEKF++DYKLV+CPTVCNFCKV+C D+G+ I ++G RRLA+SDVPFKVMFKKA Sbjct: 152 FKIEKFERDYKLVYCPTVCNFCKVICKDVGIFI-QDGIRRLALSDVPFKVMFKKA 205 >ref|NP_001312135.1| miraculin-like precursor [Nicotiana tabacum] gb|AAC49969.1| tumor-related protein [Nicotiana tabacum] Length = 210 Score = 94.0 bits (232), Expect = 3e-21 Identities = 42/55 (76%), Positives = 51/55 (92%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEKF++DYKLV+CPTVCNFCKV+C D+G+ I ++G RRLA+SDVPFKVMFKKA Sbjct: 152 FKIEKFERDYKLVYCPTVCNFCKVICKDVGIFI-QDGIRRLALSDVPFKVMFKKA 205 >ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris] Length = 210 Score = 94.0 bits (232), Expect = 3e-21 Identities = 42/55 (76%), Positives = 51/55 (92%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEKF++DYKLV+CPTVCNFCKV+C D+G+ I ++G RRLA+SDVPFKVMFKKA Sbjct: 152 FKIEKFERDYKLVYCPTVCNFCKVICKDVGIFI-QDGIRRLALSDVPFKVMFKKA 205 >gb|OMP05594.1| Proteinase inhibitor I3, Kunitz legume [Corchorus olitorius] Length = 204 Score = 93.6 bits (231), Expect = 4e-21 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK++KDYKLVFCPTVC+FCKV+C D+GV I G RRLA+SDVPF+VMF KA Sbjct: 150 FKIEKYEKDYKLVFCPTVCDFCKVICRDVGVFIDHRGVRRLALSDVPFRVMFNKA 204 >ref|XP_016512642.1| PREDICTED: miraculin-like [Nicotiana tabacum] Length = 205 Score = 93.6 bits (231), Expect = 4e-21 Identities = 41/55 (74%), Positives = 51/55 (92%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKI+KF++DYKLV+CPTVCNFCKV+C D+G+ I ++G RRLA+SDVPFKVMFKKA Sbjct: 152 FKIDKFERDYKLVYCPTVCNFCKVICKDVGIFI-QDGTRRLALSDVPFKVMFKKA 205 >gb|ONI06686.1| hypothetical protein PRUPE_5G074500 [Prunus persica] Length = 207 Score = 93.6 bits (231), Expect = 4e-21 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKK 225 FKIEKF DYKLVFCPTVCNFCKV+CGD+G+ ++GKRRLA+SDVPF+ MFKK Sbjct: 155 FKIEKFGDDYKLVFCPTVCNFCKVICGDVGI-FFQDGKRRLALSDVPFRAMFKK 207 >ref|XP_007211211.1| kunitz trypsin inhibitor 2 [Prunus persica] Length = 208 Score = 93.6 bits (231), Expect = 4e-21 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKK 225 FKIEKF DYKLVFCPTVCNFCKV+CGD+G+ ++GKRRLA+SDVPF+ MFKK Sbjct: 155 FKIEKFGDDYKLVFCPTVCNFCKVICGDVGI-FFQDGKRRLALSDVPFRAMFKK 207 >gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus] Length = 159 Score = 92.0 bits (227), Expect = 5e-21 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -3 Query: 386 FKIEKFDKDYKLVFCPTVCNFCKVVCGDIGVKIAENGKRRLAISDVPFKVMFKKA 222 FKIEK++ YKLV+CPTVC+ C+ VCGDIGV AENG RRLAISDVPFK+ F+KA Sbjct: 105 FKIEKYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA 159