BLASTX nr result
ID: Chrysanthemum21_contig00048418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00048418 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY63107.1| hypothetical protein LSAT_8X54161 [Lactuca sativa] 70 7e-13 >gb|PLY63107.1| hypothetical protein LSAT_8X54161 [Lactuca sativa] Length = 90 Score = 70.1 bits (170), Expect = 7e-13 Identities = 32/52 (61%), Positives = 44/52 (84%) Frame = +1 Query: 217 ELDDFTKERADKAVIEAMKSYKPHPEEVTQNLSEQISESLQNERVPRKQLKE 372 ELDDF KERA+KAVIEAM+SY+P PEEVT+ + ++++SLQ E+ RKQL++ Sbjct: 5 ELDDFLKERANKAVIEAMRSYEPDPEEVTKTFAIEVTQSLQGEKPSRKQLRD 56