BLASTX nr result
ID: Chrysanthemum21_contig00048334
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00048334 (524 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023773054.1| uncharacterized protein LOC111921700 [Lactuc... 75 2e-14 gb|OTF93953.1| putative pollen allergen ole e 6 [Helianthus annuus] 57 5e-08 gb|OTG09956.1| putative pollen allergen ole e 6 [Helianthus annuus] 53 3e-06 >ref|XP_023773054.1| uncharacterized protein LOC111921700 [Lactuca sativa] Length = 84 Score = 74.7 bits (182), Expect = 2e-14 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 238 EKCYNGCEKTCVDEGNARSFCMLRCEKECLKGYTARRLSR 119 +KCY CEK+C+DEGNARSFCML+CEKEC KG+ ARR SR Sbjct: 45 DKCYTDCEKSCIDEGNARSFCMLKCEKECRKGHIARRFSR 84 >gb|OTF93953.1| putative pollen allergen ole e 6 [Helianthus annuus] Length = 67 Score = 57.4 bits (137), Expect = 5e-08 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -2 Query: 238 EKCYNGCEKTCVDEGNARSFCMLRCEKECLKGYTARRLS 122 E+C+ CEK CV+ GNA SFC+L+CE+EC KG +RR + Sbjct: 29 ERCFKDCEKFCVNGGNAHSFCVLKCERECRKGNLSRRFN 67 >gb|OTG09956.1| putative pollen allergen ole e 6 [Helianthus annuus] Length = 74 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/38 (60%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -2 Query: 229 YNGCEKTCVDEGNARSFCMLRCEKEC-LKGYTARRLSR 119 Y CEK C+D+GNA SFC L+CEKE +KG+ ARR R Sbjct: 37 YADCEKNCIDDGNASSFCTLKCEKEFNMKGHIARRFGR 74