BLASTX nr result
ID: Chrysanthemum21_contig00048057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00048057 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH95489.1| Pathogenic type III effector avirulence factor Av... 54 1e-06 >gb|KVH95489.1| Pathogenic type III effector avirulence factor Avr cleavage site-containing protein [Cynara cardunculus var. scolymus] Length = 91 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/42 (54%), Positives = 27/42 (64%) Frame = -3 Query: 429 NAHYKDDESVSLNTTQKRRHHHNCHEQSSMIKSNSLLCCFFP 304 N K +E SL +RRHHHNCH+Q S +KSN L CFFP Sbjct: 46 NLQLKANEIDSLKIKHQRRHHHNCHKQPSFVKSNPFLRCFFP 87