BLASTX nr result
ID: Chrysanthemum21_contig00047802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00047802 (564 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023728374.1| uncharacterized protein LOC111876074 [Lactuc... 56 1e-06 ref|XP_023767493.1| uncharacterized protein LOC111916084 [Lactuc... 54 9e-06 ref|XP_023739863.1| uncharacterized protein LOC111887963 [Lactuc... 53 9e-06 >ref|XP_023728374.1| uncharacterized protein LOC111876074 [Lactuca sativa] Length = 135 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +1 Query: 229 TLWWNIWTYRNRLLFDVKTPLKANIYDNVVSGSFYWCRFRC-KISFSQDEWLKNPY 393 T +W IW +RN ++F KTP K+ I+D+VV S+ W RC K + S WL +P+ Sbjct: 74 TTFWCIWNFRNNVIFRAKTPKKSLIFDDVVHKSYVWISSRCSKANISWSSWLHSPF 129 >ref|XP_023767493.1| uncharacterized protein LOC111916084 [Lactuca sativa] Length = 135 Score = 53.5 bits (127), Expect = 9e-06 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 229 TLWWNIWTYRNRLLFDVKTPLKANIYDNVVSGSFYWCRFRC-KISFSQDEWLKNP 390 T +W IW +RN ++F TP K+ I+D+VV S+ W RC K S WL NP Sbjct: 74 TTFWCIWNFRNGVIFKADTPKKSLIFDDVVHKSYVWISSRCSKAKISWSSWLHNP 128 >ref|XP_023739863.1| uncharacterized protein LOC111887963 [Lactuca sativa] Length = 123 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 229 TLWWNIWTYRNRLLFDVKTPLKANIYDNVVSGSFYWCRFRC-KISFSQDEWLKNP 390 T +W IW +RN ++F TP K+ I+D+VV S+ W RC K S WL NP Sbjct: 62 TTFWCIWNFRNVVIFRANTPKKSLIFDDVVHKSYVWISSRCSKAKISWSSWLHNP 116